SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g08590

Feature Type:gene_model
Chromosome:Gm11
Start:6078276
stop:6079157
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g08590
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G17705AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: plasma membrane; EXPRESSED IN: cultured cell; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT4G08330.1); Has 135 Blast hits to 135 proteins in 32 species: Archae - 5; Bacteria - 29; Metazoa - 0; Fungi - 0; Plants - 91; Viruses - 0; Other Eukaryotes - 10 (source: NCBI BLink). | chr2:7692506-7692889 FORWARD LENGTH=127 SoyBaseE_val: 4.00E-65ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_D7L9H5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein-methionine-s-oxide reductase n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7L9H5_ARALL SoyBaseE_val: 4.00E-63ISS
UniRef100_I1LI53UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LI53_SOYBN SoyBaseE_val: 7.00E-89ISS

Expression Patterns of Glyma11g08590
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g08590
ParalogEvidenceComments
Glyma01g36711 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g08590 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g081000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g08590
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g08590
>Glyma11g08590.2   sequence type=CDS   gene model=Glyma11g08590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCCGTGTACAGCTGTACGGAGTGCGGATCCAACCTGAATCTTAACTCCGCTCATGCCTACCCTCCAGACTTCTACTTCGAAGCCGGCAACAAGGGCTCCGTCTCCTTCTCCGCCGTGGACCCCACCAAGTTCAAGTTCGAGAAGGAGGACAAGCTTCGCCCCTTCTTCGAAACCGTCAACTACTGGGGAATCCAGAGGAAGAGGACCAAGATCAAGTGCAACACCTGTGACTGTCTCCTTGGCTACGTCTATGACGATGGTCCACCTCTTACCAATAGTCCCGGTCAATTTCACATGGGTCCTAGCCAAGTTATCCCCAGAGCGCCAAGATATAGGTTCAAGACCAAAACCCTCAGAATCACTTCAACTTAA
Predicted protein sequences of Glyma11g08590
>Glyma11g08590.2   sequence type=predicted peptide   gene model=Glyma11g08590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASVYSCTECGSNLNLNSAHAYPPDFYFEAGNKGSVSFSAVDPTKFKFEKEDKLRPFFETVNYWGIQRKRTKIKCNTCDCLLGYVYDDGPPLTNSPGQFHMGPSQVIPRAPRYRFKTKTLRITST*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo