SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g08570): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g08570): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g08570

Feature Type:gene_model
Chromosome:Gm11
Start:6069900
stop:6072242
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g08570
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G17710AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 39 Blast hits to 39 proteins in 14 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 39; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:7693856-7694554 FORWARD LENGTH=152 SoyBaseE_val: 5.00E-38ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6SYM2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SYM2_SOYBN SoyBaseE_val: 1.00E-120ISS

Expression Patterns of Glyma11g08570
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g08570 not represented in the dataset
Glyma11g08570 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g08570
ParalogEvidenceComments
Glyma01g36720 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g08570 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g080800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g08570
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g08570
>Glyma11g08570.1   sequence type=CDS   gene model=Glyma11g08570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCAAGAAGTGGTTCCAAGGTCACTAGCACCACCACCACCACCACCACCTCCTCCACTTCCAAAATTCAGGGTCTTCTCAAGACCAAGAGCAGAAGAGAGTGTCACAAACCGAGAAATCGCCAAGTTTTGGAGGCAAAAGAGGATCGTGGAGGAGGACCACCTCCTTGCTGCTATCAAGGCTGTGGCTAGACTCCGTGCACGCACTCTCACGGAGCAAGAGTACGAGAGGTTCGAGTTGTCTCTGAAGACCGATAATAATGACTACGATGAAACCGAGAAAGAAACGGTGAAGTGGATCGTAGGGACAAATGCTTATTGCAAAACAGTTGCTAAGGACCAAGAAGTGCGCATCGGAATCAAGGATTGGTGGACAAAAAGCAAATATGCGTATTTGAATCAACCAGCCATAGATTCCATGGATCCTCCTAAGAAACGAACCACTACGTATGTTCCCAACTTTCTTTCTTACCAGCCCAAGCCTTTGTATCCTTCTGCTATTGGTGTCTTTTAA
Predicted protein sequences of Glyma11g08570
>Glyma11g08570.1   sequence type=predicted peptide   gene model=Glyma11g08570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKQEVVPRSLAPPPPPPPPPLPKFRVFSRPRAEESVTNREIAKFWRQKRIVEEDHLLAAIKAVARLRARTLTEQEYERFELSLKTDNNDYDETEKETVKWIVGTNAYCKTVAKDQEVRIGIKDWWTKSKYAYLNQPAIDSMDPPKKRTTTYVPNFLSYQPKPLYPSAIGVF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo