SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g08260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g08260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g08260

Feature Type:gene_model
Chromosome:Gm11
Start:5858172
stop:5860046
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G17850AT Annotation by Michelle Graham. TAIR10: Rhodanese/Cell cycle control phosphatase superfamily protein | chr2:7760005-7760787 REVERSE LENGTH=156 SoyBaseE_val: 7.00E-48ISS
GO:0001666GO-bp Annotation by Michelle Graham. GO Biological Process: response to hypoxia SoyBaseN/AISS
GO:0007568GO-bp Annotation by Michelle Graham. GO Biological Process: aging SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0010089GO-bp Annotation by Michelle Graham. GO Biological Process: xylem development SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0044036GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule metabolic process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG1530 KOG Rhodanese-related sulfurtransferase JGI ISS
PTHR13253Panther FAMILY NOT NAMED JGI ISS
PTHR13253:SF25Panther OS04G0249600 PROTEIN (FRAGMENT) JGI ISS
PF00581PFAM Rhodanese-like domain JGI ISS
UniRef100_C6TC19UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TC19_SOYBN SoyBaseE_val: 9.00E-105ISS
UniRef100_G7JXI1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thiosulfate sulfurtransferase n=1 Tax=Medicago truncatula RepID=G7JXI1_MEDTR SoyBaseE_val: 5.00E-64ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g08260 not represented in the dataset

Glyma11g08260 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma01g37010 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g077900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g08260.1   sequence type=CDS   gene model=Glyma11g08260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGTTGCTGTAGCCATGTTACCTCGTTGGTCGGTTTTTCTTCTTTTTCTGTTTGTCTTGTGTATCTCAGGAGCAAAGGTTGTCACCATTGATGTACGTGCAGCCAAGAGTCTCATCCAGACCGGTTCCATTTATCTTGATGTTAGGACGGTGGAGGAGTTCAAGAAAGGGCATGTGTATGCAGATAATGTCCTTAACATTCCATACATGTTGAATACACCCAAGGGCAAGGTAAAGAATGGAGACTTTCTGAAGGAGGTTTCATCAGCTTGCAACAAAGAAGATCATCTCGTTGTGGGTTGTCAAAGTGGGGTGAGATCTCTGTATGCAACTGCTGATCTTCTATCTGATGGTTTTAAGAATGCGAAAGACATGGGAGGAGGTTATGTGGATTGGGTTAAAAACAAGTTTCCAGTGAATATACCAGAGGCCAAAGAGGAGCTATAA

>Glyma11g08260.1   sequence type=predicted peptide   gene model=Glyma11g08260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVAVAMLPRWSVFLLFLFVLCISGAKVVTIDVRAAKSLIQTGSIYLDVRTVEEFKKGHVYADNVLNIPYMLNTPKGKVKNGDFLKEVSSACNKEDHLVVGCQSGVRSLYATADLLSDGFKNAKDMGGGYVDWVKNKFPVNIPEAKEEL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo