SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G66190 | AT | Annotation by Michelle Graham. TAIR10: ferredoxin-NADP(+)-oxidoreductase 1 | chr5:26451203-26453012 REVERSE LENGTH=360 | SoyBase | E_val: 0 | ISS |
| GO:0000165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: MAPK cascade | SoyBase | N/A | ISS |
| GO:0006098 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt | SoyBase | N/A | ISS |
| GO:0006364 | GO-bp | Annotation by Michelle Graham. GO Biological Process: rRNA processing | SoyBase | N/A | ISS |
| GO:0006612 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane | SoyBase | N/A | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0009595 | GO-bp | Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus | SoyBase | N/A | ISS |
| GO:0009657 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plastid organization | SoyBase | N/A | ISS |
| GO:0009697 | GO-bp | Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009767 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport chain | SoyBase | N/A | ISS |
| GO:0009773 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I | SoyBase | N/A | ISS |
| GO:0009814 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction | SoyBase | N/A | ISS |
| GO:0009862 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009867 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010200 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to chitin | SoyBase | N/A | ISS |
| GO:0010207 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosystem II assembly | SoyBase | N/A | ISS |
| GO:0010310 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process | SoyBase | N/A | ISS |
| GO:0010363 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response | SoyBase | N/A | ISS |
| GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
| GO:0019684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction | SoyBase | N/A | ISS |
| GO:0019761 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process | SoyBase | N/A | ISS |
| GO:0031348 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response | SoyBase | N/A | ISS |
| GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
| GO:0043085 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity | SoyBase | N/A | ISS |
| GO:0043900 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process | SoyBase | N/A | ISS |
| GO:0050832 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to fungus | SoyBase | N/A | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009534 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid | SoyBase | N/A | ISS |
| GO:0009535 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane | SoyBase | N/A | ISS |
| GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
| GO:0009579 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: thylakoid | SoyBase | N/A | ISS |
| GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
| GO:0031977 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen | SoyBase | N/A | ISS |
| GO:0048046 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: apoplast | SoyBase | N/A | ISS |
| GO:0003959 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: NADPH dehydrogenase activity | SoyBase | N/A | ISS |
| GO:0004324 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ferredoxin-NADP+ reductase activity | SoyBase | N/A | ISS |
| GO:0008266 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: poly(U) RNA binding | SoyBase | N/A | ISS |
| GO:0016491 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity | SoyBase | N/A | ISS |
| GO:0045156 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity | SoyBase | N/A | ISS |
| GO:0045157 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: electron transporter, transferring electrons within the noncyclic electron transport pathway of photosynthesis activity | SoyBase | N/A | ISS |
| GO:0050660 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding | SoyBase | N/A | ISS |
| GO:0050661 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: NADP binding | SoyBase | N/A | ISS |
| PTHR19384 | Panther | NADPH FLAVIN OXIDOREDUCTASE | JGI | ISS | |
| PTHR19384:SF1 | Panther | FERREDOXIN--NADP REDUCTASE | JGI | ISS | |
| PF00175 | PFAM | Oxidoreductase NAD-binding domain | JGI | ISS | |
| PF00970 | PFAM | Oxidoreductase FAD-binding domain | JGI | ISS | |
| UniRef100_P10933 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Ferredoxin--NADP reductase, leaf isozyme, chloroplastic n=2 Tax=Pisum sativum RepID=FENR1_PEA | SoyBase | E_val: 0 | ISS |
| UniRef100_UPI0000F35E54 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0000F35E54 related cluster n=1 Tax=unknown RepID=UPI0000F35E54 | SoyBase | E_val: 0 | ISS |
|
Glyma11g08230 not represented in the dataset |
Glyma11g08230 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma01g37051 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.11g077600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma11g08230.1 sequence type=CDS gene model=Glyma11g08230 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCTACTGCGGTAACTGCTGCAGTGTCCTTTCCAGCCACCAAGTCCACTTCTCTTTCAAGCAGAACCTCTATCACTGCCCCAGATAGAATTGTCTTCAAGAAGGTTTCGTTGCAATACAGAGATGTTTCAACCAGTGGAAGGGTAGTTTCAATCAGAGCACAAGTGACCACAGAGGCACCTGCTAAGGTTGAAAAGGAATCAAAGAAACAGGAGGAAGGTGTGATCGTGAACAAGTTCAAACCCAAGAACCCATATATTGGTAGGTGTCTTCTCAACACAAAGATCACTGGGGATGATGCACCTGGAGAAACTTGGCACATGGTCTTCAGCACTGAGGGAGAAGTTCCTTACAGAGAAGGACAATCAATCGGGGTAATTCCTGATGGGGTTGACAAGAATGGCAAGCCTCACAAGCTGAGATTGTATTCAATTGCTAGCAGTGCCCTTGGTGATTTTGGAGATTCCAAAACTGTTTCTTTATGCGTGAAACGTCTTGTGTACACAAATGAAAACGGAGAACTTGTCAAAGGAGTTTGCTCAAATTTCTTGTGCGACTTGAAGCCAGGAGCCGAAGTAAAGATTACTGGACCTGTTGGTAAAGAAATGCTTATGCCAAAAGATCCTAATGCAACCGTCATCATGTTGGCAACTGGAACAGGAATTGCCCCATTCCGCTCATTTTTATGGAAAATGTTCTTTGAGAAGCATGATGATTACAAGTTCAATGGTTTGGCATGGCTCTTCTTGGGTGTCCCCACAAGCAGCTCACTACTTTATAAGGAGGAATTTGAAAAGATGAAGGAGAAAGCACCTGACAACTTCAGGCTTGACTTTGCTGTGAGCAGAGAGCAAACAAACGAAAAAGGAGAGAAAATGTACATCCAAACACGAATGGCTCAATATGCAGAAGAGTTATGGGAATTACTGAAGAAAGATAACACTTTTGTCTATATGTGTGGACTGAAGGGAATGGAAAAGGGTATAGATGACATAATGGTTTCATTGGCTGCAAAAGATGGTATTGATTGGATTGAGTACAAGAGGCAATTGAAGAAGGCAGAGCAATGGAATGTCGAAGTCTACTAA
>Glyma11g08230.1 sequence type=predicted peptide gene model=Glyma11g08230 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MATAVTAAVSFPATKSTSLSSRTSITAPDRIVFKKVSLQYRDVSTSGRVVSIRAQVTTEAPAKVEKESKKQEEGVIVNKFKPKNPYIGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGVIPDGVDKNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNENGELVKGVCSNFLCDLKPGAEVKITGPVGKEMLMPKDPNATVIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPDNFRLDFAVSREQTNEKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRQLKKAEQWNVEVY*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
