Glyma11g08050 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g08050): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g08050): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g08050

Feature Type:	gene_model
Chromosome:	Gm11
Start:	5679234
stop:	5680943
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g08050

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G36130	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein L2 family \| chr4:17097613-17098656 FORWARD LENGTH=258	SoyBase	E_val: 0	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0022625	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit	SoyBase	N/A	ISS
GO:0022626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG2309	KOG	60s ribosomal protein L2/L8	JGI		ISS
PTHR13691	Panther	RIBOSOMAL PROTEIN L2	JGI		ISS
PTHR13691:SF4	Panther	gb def: 60s ribosomal protein l8 [encephalitozoon cuniculi]	JGI		ISS
PF00181	PFAM	Ribosomal Proteins L2, RNA binding domain	JGI		ISS
PF03947	PFAM	Ribosomal Proteins L2, C-terminal domain	JGI		ISS
UniRef100_D7MBP3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L8 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MBP3_ARALL	SoyBase	E_val: 0	ISS
UniRef100_I1LI06	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LI06_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma11g08050

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g08050 not represented in the dataset	Glyma11g08050 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g08050

Paralog	Evidence	Comments
Glyma01g37250	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g08050 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g076000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g08050

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g08050

Limit To All Plant Sequences

>Glyma11g08050.1   sequence type=CDS   gene model=Glyma11g08050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAGGGTGATTCGCGCACAGCGTAAGGGTGCGGGGTCGGTGTTCAAGTCCCACACCCACCACCGCAAGGGTCCGGCGAGGTTCCGCAGCCTCGACTTCGGCGAGCGCAACGGCTACCTCAAAGGGGTCGTCACCGATATCATCCACGACCCTGGTCGCGGTGCTCCTCTAGCCAAGGTGGCGTTCCGCCACCCCTTCCGCTACAAGAAGCAGATGGAGCTCTTCGTCGCCGCCGAGGGCCTCTACACCGGCCAGTTCATCTACTGCGGCAAGAAGGCCACCCTCGTCGTCGGCAACGTCTTGCCCCTCCGATCCATCCCCGAAGGTGCCGTTATCTGCAACGTCGAGCACCACGTTGGCGACCGCGGCGTCTTCGCCAGAGCCTCCGGTGACTATGCCATTGTTATCAGCCACAACCCTGATAACGACACCTCTAGGATCAAGCTTCCTTCTGGGTCAAAGAAGATTGTGCCTAGTGGGTGCAGGGCGATGATTGGGCAGGTTGCAGGTGGAGGGAGGACTGAGAAGCCTCTTCTGAAAGCTGGTAATGCTTATCACAAATTCAGAGTGAAGAGGAATTGCTGGCCTAAGGTGCGTGGTGTGGCGATGAACCCAGTTGAGCATCCTCATGGAGGAGGTAATCACCAGCATATTGGTCATGCCAGTACCGTCAGGCGTGATGCTCCTCCTGGCCAGAAGGTTGGTCTCATTGCTGCTAGGAGGACTGGTCGTCTTAGGGGGCAAGCTGCTGCTACTGCTGCTAAAGCGGATAAGACCACCTGA

Predicted protein sequences of Glyma11g08050

Limit To All Plant Sequences

>Glyma11g08050.1   sequence type=predicted peptide   gene model=Glyma11g08050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAKVAFRHPFRYKKQMELFVAAEGLYTGQFIYCGKKATLVVGNVLPLRSIPEGAVICNVEHHVGDRGVFARASGDYAIVISHNPDNDTSRIKLPSGSKKIVPSGCRAMIGQVAGGGRTEKPLLKAGNAYHKFRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAARRTGRLRGQAAATAAKADKTT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain