Glyma11g08000 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g08000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g08000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g08000

Feature Type:	gene_model
Chromosome:	Gm11
Start:	5649570
stop:	5650794
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g08000

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G18050	AT	Annotation by Michelle Graham. TAIR10: histone H1-3 \| chr2:7846095-7846670 FORWARD LENGTH=167	SoyBase	E_val: 5.00E-36	ISS
GO:0006334	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleosome assembly	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0000786	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleosome	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0031492	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleosomal DNA binding	SoyBase	N/A	ISS
PTHR11467	Panther	HISTONE H1/H5	JGI		ISS
PF00538	PFAM	linker histone H1 and H5 family	JGI		ISS
UniRef100_I1LI02	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LI02_SOYBN	SoyBase	E_val: 3.00E-122	ISS
UniRef100_Q8H6B7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Histone H1D n=1 Tax=Nicotiana tabacum RepID=Q8H6B7_TOBAC	SoyBase	E_val: 1.00E-55	ISS

Expression Patterns of Glyma11g08000

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g08000 not represented in the dataset	Glyma11g08000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g08000

Paralog	Evidence	Comments
Glyma01g37296	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g08000 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g075500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g08000

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g08000

Limit To All Plant Sequences

>Glyma11g08000.1   sequence type=CDS   gene model=Glyma11g08000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCGCCGCCGAAGAAGCTAAAGTTCCCGCCGTCGAAAAGCCGGTGGAGGAGGTGAAGGCGCCGAAGCTTGCCAAGGAGAAGAAACCTAAGGCTCCGAAGGAAAAGAAGCCGAAACAGGCCAAAACTGCTTCTCATCCTCCATATCTCCAGATGATTAAGGACGCTTTGATTGCTCTGAACGAGAAAGGAGGATCGAGTCCATATGCGATAGCGAAGTACATGGAGGAGAAGCACAAGGCGGTGCTTCCTGCGAATTTCAAGAAGATACTAGGTCTGCAACTGAAGAACCAAGCTGCGAGAGGGAAACTCGTCAAGATCAAGGCTTCGTACAAGTTAGCCGAAGCCGCGAAGAAGGTGAAGGAGAGCACCGCCAAAGCGACGAAGGAATCGCGTCCGAAACGAAACAAAATCGCAACCGCCGTTGCTCCGAAGAAAACCGAGGCGGTTAAAAAGCCCGCGAAGAAGGTCGGGCCGAAGAAAACGAAGAAAGTGTCGACGCCTGCGAAGCCCAAGCAGCCCAGGTCCATTAGGTCTCCGACCAAGAGGGCCCGTAAAGCTGCCGTCGCTGCGGCTTGA

Predicted protein sequences of Glyma11g08000

Limit To All Plant Sequences

>Glyma11g08000.1   sequence type=predicted peptide   gene model=Glyma11g08000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSAAEEAKVPAVEKPVEEVKAPKLAKEKKPKAPKEKKPKQAKTASHPPYLQMIKDALIALNEKGGSSPYAIAKYMEEKHKAVLPANFKKILGLQLKNQAARGKLVKIKASYKLAEAAKKVKESTAKATKESRPKRNKIATAVAPKKTEAVKKPAKKVGPKKTKKVSTPAKPKQPRSIRSPTKRARKAAVAAA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain