SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g07730

Feature Type:gene_model
Chromosome:Gm11
Start:5429679
stop:5431653
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g07730
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G75500AT Annotation by Michelle Graham. TAIR10: Walls Are Thin 1 | chr1:28338282-28340091 REVERSE LENGTH=389 SoyBaseE_val: 5.00E-124ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0007389GO-bp Annotation by Michelle Graham. GO Biological Process: pattern specification process SoyBaseN/AISS
GO:0008361GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell size SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009826GO-bp Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth SoyBaseN/AISS
GO:0009834GO-bp Annotation by Michelle Graham. GO Biological Process: secondary cell wall biogenesis SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010015GO-bp Annotation by Michelle Graham. GO Biological Process: root morphogenesis SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0090355GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of auxin metabolic process SoyBaseN/AISS
GO:0090358GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of tryptophan metabolic process SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009705GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type vacuole membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
PF00892PFAM EamA-like transporter family JGI ISS
UniRef100_G7KGA5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein 5NG4 n=1 Tax=Medicago truncatula RepID=G7KGA5_MEDTR SoyBaseE_val: 0ISS
UniRef100_UPI0001BA8184UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001BA8184 related cluster n=1 Tax=unknown RepID=UPI0001BA8184 SoyBaseE_val: 0ISS

Expression Patterns of Glyma11g07730
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g07730
ParalogEvidenceComments
Glyma01g37571 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g07730 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g072800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g07730
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g07730
>Glyma11g07730.1   sequence type=CDS   gene model=Glyma11g07730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGCCTCAACGAGCTAATCTTCACATAGCCTTAACATTTTTACAATTTTGTTATGCAGGAAATCATATATTTCTGAGAATTGCACTTGATACAGGCGTAAGCAAGCTTATTTTTCCTGTCCATAGAAACATCACCGCCTTGGTTCTTCTGGGTCCCCTCGCATATTTTTCAGAGAAAATAACAATGAAAGAAGGATTCTACCTCTTGGGTTTGGAGAAAACATCACCTACTTTTGCTGCTGCTATGCAGAATTCTGTTCCAGCACTTACCTTTCTGATGGCTTGCAGATATGAGAGTGTGCACTTCAACAGGATTGATGGTCTGGCTAAGGTCCTTGGAGTCCTTGCTTCTGTTGGAGGAGCTTCAATCATTACCCTTTACAAGGGACCTGTTATTTATACTCCGCGTTTAGCATTACATCAGGAACAATACTTGTCTGTATTGGGGGATGCCACAGGAAAGAACTGGAACTTGGGTGGCATCTATCTCTTTGGTCACTCCTTATGTTGGTCTGGTTGGATTGTGATGCAAGCATTTGTTCTGAAAAAATACTCAGCCCCACTCACAGTTTCTGCTTTTACATGCTTCTTTGGTGTTGTGCAGTTTTTGACAATTGCAGCCTTTTTTGAGACGGATTCCAAAGCCTGGCAGTTCAATTCTAGTGGAGAGATCTTCAGTGCCTTGTTCTCGGGACTGGTGACTTCAGGGCTGGCATCAGCAATACAGATATGGACTATTGGCAAAGGAGGGCCAGTGCTTGCTTCAATTTATCTACCTTTACAAACATTACTTGTATCTGTGATGGCATCTTTTATTTTCGGTGAAGAATTCTTCTTGGGAGGCATTATTGGAGCATTCTTAATTATATCCGGCTTGTACCTTGTTGTCTGGGGAAGAAGTCAAGAAACCAAGTATGCCAAAGAGGTCATAGTCCCCATTGAGCCCAAGAATCATTGGGAAGAAAAAAGTGACAGTTCTTTCCTCATCCAACGATTGATTACTACACAAAGCTCTTAG
Predicted protein sequences of Glyma11g07730
>Glyma11g07730.1   sequence type=predicted peptide   gene model=Glyma11g07730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMPQRANLHIALTFLQFCYAGNHIFLRIALDTGVSKLIFPVHRNITALVLLGPLAYFSEKITMKEGFYLLGLEKTSPTFAAAMQNSVPALTFLMACRYESVHFNRIDGLAKVLGVLASVGGASIITLYKGPVIYTPRLALHQEQYLSVLGDATGKNWNLGGIYLFGHSLCWSGWIVMQAFVLKKYSAPLTVSAFTCFFGVVQFLTIAAFFETDSKAWQFNSSGEIFSALFSGLVTSGLASAIQIWTIGKGGPVLASIYLPLQTLLVSVMASFIFGEEFFLGGIIGAFLIISGLYLVVWGRSQETKYAKEVIVPIEPKNHWEEKSDSSFLIQRLITTQSS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo