SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g07160): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g07160): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g07160

Feature Type:gene_model
Chromosome:Gm11
Start:5021304
stop:5022275
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g07160
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G50685AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 52 Blast hits to 46 proteins in 20 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 45; Viruses - 0; Other Eukaryotes - 7 (source: NCBI BLink). | chr3:18834272-18834748 REVERSE LENGTH=158 SoyBaseE_val: 2.00E-71ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0019761GO-bp Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process SoyBaseN/AISS
GO:0046777GO-bp Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6SVH0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SVH0_SOYBN SoyBaseE_val: 4.00E-114ISS
UniRef100_Q941E5UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT3g50680/T3A5_60 n=1 Tax=Arabidopsis thaliana RepID=Q941E5_ARATH SoyBaseE_val: 1.00E-68ISS

Expression Patterns of Glyma11g07160
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g07160 not represented in the dataset
Glyma11g07160 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g07160 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g067100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g07160
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g07160
>Glyma11g07160.2   sequence type=CDS   gene model=Glyma11g07160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CCGAAAAGAGCATCCGACTCGTGCTTGCTCTCTCTGTGGTTTTGGGTCTCTCTCACTCACAGGCACAGCAACAGCACCATGGAAGGCGCAACGATGTTACTGTTGTCGCCAATATCGAGCTGCAACGTGCGCAGTAAGCATTTAAACTACTCACTCAGAAGGCGTAGCTGTTATTCTTCTCCCAGGGCACTGAAAATAGTGAGCATGGCGAAGGAGGGAAGCGACACCGGCAACGGCGTGGTAGAAAAAGCAGCCATAGCGGGTGGATTGATCTCAACCCCAGTAATTGCTTGGTCTCTCTATACTCTCAAAACAACAGGGTGCGGTCTTCCCCCAGGACCAGGTGGGTCAATTGGAGCATTGGAGGGTGTGAGCTACCTCGTGGTAGTGGGCATAGTGGGTTGGAGCTTGTACACTAAAGCCAAAACCGGTTCGGGACTTCCCAACGGTCCTTTCGGGTTGTTGGGTGCCGTGGAAGGATTCTCCTATTTGGCATTGGTTGCGATTGTGGTCGTGTTCGGGTTGCAATTCCTTGACAAGGGTTACATCCCTGGTCCTCTCCCCGCCGATCAGTGCTTTGGCTAG
Predicted protein sequences of Glyma11g07160
>Glyma11g07160.2   sequence type=predicted peptide   gene model=Glyma11g07160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
PKRASDSCLLSLWFWVSLTHRHSNSTMEGATMLLLSPISSCNVRSKHLNYSLRRRSCYSSPRALKIVSMAKEGSDTGNGVVEKAAIAGGLISTPVIAWSLYTLKTTGCGLPPGPGGSIGALEGVSYLVVVGIVGWSLYTKAKTGSGLPNGPFGLLGAVEGFSYLALVAIVVVFGLQFLDKGYIPGPLPADQCFG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo