SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g06970): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g06970): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g06970

Feature Type:gene_model
Chromosome:Gm11
Start:4912974
stop:4917377
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g06970
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G36720AT Annotation by Michelle Graham. TAIR10: HVA22-like protein K | chr4:17307769-17309668 FORWARD LENGTH=200 SoyBaseE_val: 5.00E-87ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG1725 KOG Protein involved in membrane traffic (YOP1/TB2/DP1/HVA22 family) JGI ISS
PTHR12300Panther HVA22-LIKE PROTEINS JGI ISS
PTHR12300:SF12Panther HVA22-LIKE PROTEIN JGI ISS
PF03134PFAM TB2/DP1, HVA22 family JGI ISS
UniRef100_C6T9S9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T9S9_SOYBN SoyBaseE_val: 3.00E-141ISS
UniRef100_G7KC81UniRef Annotation by Michelle Graham. Most informative UniRef hit: Receptor expression-enhancing protein n=1 Tax=Medicago truncatula RepID=G7KC81_MEDTR SoyBaseE_val: 3.00E-97ISS

Expression Patterns of Glyma11g06970
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g06970 not represented in the dataset
Glyma11g06970 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g06970
ParalogEvidenceComments
Glyma01g38370 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g06970 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g065100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g06970
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g06970
>Glyma11g06970.1   sequence type=CDS   gene model=Glyma11g06970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCTCCTTGGATCAAACATAACAAGCGAGGTTGGACTCCGTTTGCTCCTTTGTCCTCTTGGTTCCAACGTTGTAATTAGAACAGCATGCTGTACTGTGGGAGTTGCTTTGCCTGTGTACTCTACGTTCAAGGCAATAGAAAGTAAAGATCAAGATGCTCAGCATAAGTGTCTTCTCTACTGGGCAGCCTATGGTTCATTCAGTCTCGCTGAAGTGTTCACGGACAAGCTTATTTCTTGGTGTCCTATCTACTATCACCTGAAGTTTGCATTTCTTGTTTGGCTTCAACTTCCATCTACCAGTGGTGCAAAACAAATATATGCAAACCACTTGCGCCCCTTCTTGTTGAGGCATCAAGCACGAGTTGATCAAGTCTTGGGTTTTGCATATTGTGAAGTGATAAAACTCGTGAGTTCATACCAAGCAGAGATCCAGTTTGTCAGGAGCATGGTAGTAAAGATAACTGGATCAGCGGATCAAATGTTGAGAGGCGGTGCTGAATCAGATAGATCGCCGCAACATATTTCAGCCGAAGACCCCGCCTCTGATGCTGAATCTGACCAAAACCACAATCACTGA
Predicted protein sequences of Glyma11g06970
>Glyma11g06970.1   sequence type=predicted peptide   gene model=Glyma11g06970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALLGSNITSEVGLRLLLCPLGSNVVIRTACCTVGVALPVYSTFKAIESKDQDAQHKCLLYWAAYGSFSLAEVFTDKLISWCPIYYHLKFAFLVWLQLPSTSGAKQIYANHLRPFLLRHQARVDQVLGFAYCEVIKLVSSYQAEIQFVRSMVVKITGSADQMLRGGAESDRSPQHISAEDPASDAESDQNHNH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo