SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g06330): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g06330): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g06330

Feature Type:gene_model
Chromosome:Gm11
Start:4499027
stop:4501573
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G23620AT Annotation by Michelle Graham. TAIR10: methyl esterase 1 | chr2:10047462-10049248 REVERSE LENGTH=263 SoyBaseE_val: 6.00E-95ISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009696GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid metabolic process SoyBaseN/AISS
GO:0009817GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016788GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds SoyBaseN/AISS
GO:0080030GO-mf Annotation by Michelle Graham. GO Molecular Function: methyl indole-3-acetate esterase activity SoyBaseN/AISS
GO:0080031GO-mf Annotation by Michelle Graham. GO Molecular Function: methyl salicylate esterase activity SoyBaseN/AISS
GO:0080032GO-mf Annotation by Michelle Graham. GO Molecular Function: methyl jasmonate esterase activity SoyBaseN/AISS
KOG1454 KOG Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) JGI ISS
PTHR10992Panther ALPHA/BETA HYDROLASE RELATED JGI ISS
PTHR10992:SF56Panther gb def: abhydrolase, alpha/beta hydrolase fold [bacillus anthracis a2012] JGI ISS
UniRef100_C6TB10UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TB10_SOYBN SoyBaseE_val: 0ISS
UniRef100_G7K9E9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pentatricopeptide repeat-containing protein n=1 Tax=Medicago truncatula RepID=G7K9E9_MEDTR SoyBaseE_val: 2.00E-125ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g06330 not represented in the dataset

Glyma11g06330 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g06330.1   sequence type=CDS   gene model=Glyma11g06330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTAAAAAACAAAGAGAGCAAAATCACTTTGTCCTGGTGCATGGTATAGGCCATGGTGCCTGGTGTTGGTACAAGCTTAAGCCACTGTTGGAATCCGCCGGCCACAAAGTCACAGTCCTTGACCTTGCAGCTTCTGGCATCGACACACACGACATTGAAGACATCCACACATTTTCTGAGTATTCTAAGCCTTTGTTGGATCTCTTGGCGTCGCTTGCTCCTAATGAAAAAGTGGTCCTTGTCGGGCATAGCTTTGGAGGGATCAGTATAGCCCTTGCAATGGACAAATTCCCAGAGAAAATATCACTTGGAATTTTCCTAACAGCTTTTGTTCCTGATACCCAACACAAACCATCACATGTCTTAGAAGAGTACATTGATAGATACCCATATACCGGATGGATGGACACTGAGCTCTGGAATAGTGGAGGCAAAACAACATTGCTTTTTGGCATCAAATTCTTGTCCACTAAGTTCTATCAACTCTGCTCCACTGAGGATCTGGAATTGGTGAAGACTTTAAGAAGAAAGGGTTCACTATTTGCTGAAGACCTTTCTAAGGCAGAGAATTTTTCCAAAGAGAAAGATGGGTCTGTTCCAAGTGCTTATATTATTTCCAATGAGGACTTGGTAATTCCAAAGGAGTATCAGCAATGGATGATCCAAAATGCAGGGATTGATGTGGTGCGAGAGATCAAGGGATCAGATCACATGGTTATGCTTAGCAAACCCCACAAACTATGTTTATCTCTCCTCGAGATAGCTGATAAGCAAGTTAAGTAA

>Glyma11g06330.1   sequence type=predicted peptide   gene model=Glyma11g06330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSKKQREQNHFVLVHGIGHGAWCWYKLKPLLESAGHKVTVLDLAASGIDTHDIEDIHTFSEYSKPLLDLLASLAPNEKVVLVGHSFGGISIALAMDKFPEKISLGIFLTAFVPDTQHKPSHVLEEYIDRYPYTGWMDTELWNSGGKTTLLFGIKFLSTKFYQLCSTEDLELVKTLRRKGSLFAEDLSKAENFSKEKDGSVPSAYIISNEDLVIPKEYQQWMIQNAGIDVVREIKGSDHMVMLSKPHKLCLSLLEIADKQVK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo