SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g05620): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g05620): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g05620

Feature Type:gene_model
Chromosome:Gm11
Start:3962584
stop:3965203
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g05620
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G39220AT Annotation by Michelle Graham. TAIR10: Rer1 family protein | chr4:18264280-18265531 FORWARD LENGTH=191 SoyBaseE_val: 9.00E-69ISS
GO:0006890GO-bp Annotation by Michelle Graham. GO Biological Process: retrograde vesicle-mediated transport, Golgi to ER SoyBaseN/AISS
GO:0006891GO-bp Annotation by Michelle Graham. GO Biological Process: intra-Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG1688 KOG Golgi proteins involved in ER retention (RER) JGI ISS
PTHR10743Panther RER1 PROTEIN JGI ISS
PF03248PFAM Rer1 family JGI ISS
UniRef100_B9SFZ5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Rer1 protein, putative n=1 Tax=Ricinus communis RepID=B9SFZ5_RICCO SoyBaseE_val: 3.00E-76ISS
UniRef100_I1LHA9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LHA9_SOYBN SoyBaseE_val: 1.00E-136ISS

Expression Patterns of Glyma11g05620
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g05620 not represented in the dataset
Glyma11g05620 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g05620
ParalogEvidenceComments
Glyma01g39640 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g05620 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g052800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g05620
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g05620
>Glyma11g05620.1   sequence type=CDS   gene model=Glyma11g05620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACGTAGGAACCGCCGACGATCATTCCCCGGAAGCCGCCATATCGCGGTGGAAATTCGCGGTGTCGCGGCAGTACCAGCACATGCTGGACAAAACGACGCCGCACGTGCTCCGACGGTGGATCGGTGCCTGGTGGTTGCCGCCGTGTTACGTGCTCCGCGTGTACTTGGTCCAAGGCTTCTACATCGTCTCCTACGCCCTTCGGCATTTACATCTCACTCTCATCGGGCTTCCTCCTCCCCTTCAGGTCGATCCCGAGATTATCGGACGGCCCCACCCTCCCCATCCGAGGATCCGACAGTTCCGCCCCTTCGTTCGACGCCTCCCCGAGTTCAAGTTCTGGTACTCGATCACAAAGGCATTTTGTATTGCGTTTGTGATGACTTTCTTTAGTGCATTTGATGTTCCAGTATTCTGGCCAATACTCCTTTTCTACTGGGTGGTCCTATTCACACTTACAATGAGAAGACAAATATCACACATGATCAAATACAAATATGTACCGTTCTCATTTGGGAAACAGCGCTACGCCGGAAAGAGAGCAGCAGAAGGCACAAGCCCGACCTTGGACTGA
Predicted protein sequences of Glyma11g05620
>Glyma11g05620.1   sequence type=predicted peptide   gene model=Glyma11g05620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDVGTADDHSPEAAISRWKFAVSRQYQHMLDKTTPHVLRRWIGAWWLPPCYVLRVYLVQGFYIVSYALRHLHLTLIGLPPPLQVDPEIIGRPHPPHPRIRQFRPFVRRLPEFKFWYSITKAFCIAFVMTFFSAFDVPVFWPILLFYWVVLFTLTMRRQISHMIKYKYVPFSFGKQRYAGKRAAEGTSPTLD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo