SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g05570

Feature Type:gene_model
Chromosome:Gm11
Start:3925237
stop:3925892
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g05570
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G67265AT Annotation by Michelle Graham. TAIR10: unknown protein. | chr5:26839469-26839836 REVERSE LENGTH=78 SoyBaseE_val: 4.00E-10ISS
UniRef100_I1LHA4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LHA4_SOYBN SoyBaseE_val: 9.00E-33ISS

Expression Patterns of Glyma11g05570
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g05570
ParalogEvidenceComments
Glyma01g39710 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g05570 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g052300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g05570
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g05570
>Glyma11g05570.2   sequence type=CDS   gene model=Glyma11g05570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATGAACAAGCTGCTAAGAAGAATGACATTGTGAATGCACAAAATGGCATGGAAAAAAAGGTGGAAAGTGTGGATTATCGATCTTCAGCAGGGCAAGGGCAAGAAGAGAAGAACGTGCAGGTAAAGGTAATTCACCAGCCCCATTCTACCAACACCAGTGGTGGTGTACTTGCTGCTGCTGCAACTACTCTACAGTCTGCCAAGGATGCCATATCCAAAAAATAA
Predicted protein sequences of Glyma11g05570
>Glyma11g05570.2   sequence type=predicted peptide   gene model=Glyma11g05570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNEQAAKKNDIVNAQNGMEKKVESVDYRSSAGQGQEEKNVQVKVIHQPHSTNTSGGVLAAAATTLQSAKDAISKK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo