Report for Sequence Feature Glyma11g05500
Feature Type: gene_model
Chromosome: Gm11
Start: 3834651
stop: 3838333
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma11g05500
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G23150 AT
Annotation by Michelle Graham. TAIR10: natural resistance-associated macrophage protein 3 | chr2:9856422-9858565 REVERSE LENGTH=509
SoyBase E_val: 0 ISS
GO:0006810 GO-bp
Annotation by Michelle Graham. GO Biological Process: transport
SoyBase N/A ISS
GO:0006828 GO-bp
Annotation by Michelle Graham. GO Biological Process: manganese ion transport
SoyBase N/A ISS
GO:0006875 GO-bp
Annotation by Michelle Graham. GO Biological Process: cellular metal ion homeostasis
SoyBase N/A ISS
GO:0009617 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to bacterium
SoyBase N/A ISS
GO:0010043 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to zinc ion
SoyBase N/A ISS
GO:0015691 GO-bp
Annotation by Michelle Graham. GO Biological Process: cadmium ion transport
SoyBase N/A ISS
GO:0015692 GO-bp
Annotation by Michelle Graham. GO Biological Process: lead ion transport
SoyBase N/A ISS
GO:0030001 GO-bp
Annotation by Michelle Graham. GO Biological Process: metal ion transport
SoyBase N/A ISS
GO:0042742 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to bacterium
SoyBase N/A ISS
GO:0055072 GO-bp
Annotation by Michelle Graham. GO Biological Process: iron ion homeostasis
SoyBase N/A ISS
GO:2000379 GO-bp
Annotation by Michelle Graham. GO Biological Process: positive regulation of reactive oxygen species metabolic process
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0005773 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: vacuole
SoyBase N/A ISS
GO:0005774 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane
SoyBase N/A ISS
GO:0005794 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus
SoyBase N/A ISS
GO:0009506 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0005215 GO-mf
Annotation by Michelle Graham. GO Molecular Function: transporter activity
SoyBase N/A ISS
GO:0005384 GO-mf
Annotation by Michelle Graham. GO Molecular Function: manganese ion transmembrane transporter activity
SoyBase N/A ISS
GO:0015103 GO-mf
Annotation by Michelle Graham. GO Molecular Function: inorganic anion transmembrane transporter activity
SoyBase N/A ISS
GO:0046873 GO-mf
Annotation by Michelle Graham. GO Molecular Function: metal ion transmembrane transporter activity
SoyBase N/A ISS
KOG1291
KOG
Mn2+ and Fe2+ transporters of the NRAMP family
JGI ISS
PTHR11706 Panther
MANGANESE TRANSPORTER
JGI ISS
PTHR11706:SF8 Panther
NATURAL RESISTANCE-ASSOCIATED MACROPHAGE PROTEIN (NRAMP) (MANGANESE TRANSPORTER)
JGI ISS
PF01566 PFAM
Natural resistance-associated macrophage protein
JGI ISS
UniRef100_G7K3Y6 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Natural resistance-associated macrophage protein n=1 Tax=Medicago truncatula RepID=G7K3Y6_MEDTR
SoyBase E_val: 0 ISS
UniRef100_I1LH97 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LH97_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma11g05500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma11g05500
Paralog Evidence Comments
Glyma01g39790 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma11g05500 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.11g051500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma11g05500
Coding sequences of Glyma11g05500
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma11g05500.1 sequence type=CDS gene model=Glyma11g05500 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCCTCCTGAACAGACCCAACAACCTCTGTTATCGGAGGAGCAAGAAGAGACAGCCTACGATTCCTCGGAGAAGGTGGTGGTGGTCGGAATCGACGACCACGACGGCGACGTGGAGGCGCCGCCGTTCTCATGGCGGAAGCTGTGGCTCTTCACTGGGCCCGGGTTTCTCATGAGCATCGCGTTTTTGGATCCCGGGAATCTCGAGGGGGATCTTCAGTCCGGTGCCATTGCTGGGTACTCGCTCTTGTGGCTCCTCATGTGGGCCACGGCTATGGGCCTTATCATCCAGCTTCTCTCGGCTCGGCTCGGCGTGGCTACGGGAAGGCACTTAGCCGAACTCTGCAGAGAAGAGTATCCCACATGGGCTAGGATTGTTCTGTGGTTGATGACTGAGATTGCTCTTATTGGCGCTGACATACAAGAGGTTATTGGGAGCGCTATTGCTATCAGGATTCTTAGTAACGGCGTCGTTCCACTCTGGGCTGGTGTCGTCATTACAGCTTTTGATTGTTTTATTTTTCTCTTTCTTGAGAACTACGGTGTGAGGAAACTGGAAGCGTTTTTCGCTGTTCTGATTGGTGTAATGGCTCTCTCATTTGCCTGGATGTTTGGTGAAGCCAAGCCCAATGGTGTTGATGTTCTTGTTGGTATTTTGGTTCCTAAACTTAGCTCCAGAACTATACAGCAAGCTGTTGGAGTTGTGGGTTGCATTATTATGCCTCACAATGTGTACTTGCATTCTGCGCTTGTTCAATCAAGGCAGGTTGATCCCAGCAAGAAAGGCCGTGTTCAGGAAGCTCTTAATTACTACTCCATAGAGTCCACCATTGCCCTTATAGTGTCCTTTGTCATTAATATATTTGTCACAACTGTGTTTGCTAAGGGCTTTTATGGTACTGAAATAGCAAATAGCATTGGTCTTGTAAATGCAGGGCAGTACCTTCAAGAGAAGTATGGGGGTGGACTATTCCCAATCCTGTATATATGGGGTATCGGGTTATTAGCAGCTGGCCAGAGTAGCACAATTACTGGTACATATGCTGGACAATTTATCATGGGGGGTTTTCTGAATTTAAGGTTGAAGAAGTGGATAAGGGCATTAATTACACGAAGTTTTGCAATCATCCCAACCATAATAGTTGCTCTTATATTTGATACCTCAGAGGAATCGTTAGATGTTCTGAATGAATGGCTTAATGTTCTCCAGTCAGTTCAAATCCCCTTTGCACTCATTCCCTTGCTTTGCTTGGTGTCCAAAGAACAGATAATGGGCAGTTTCAGAATTGGCCCTGTCCTCAAGATTATTTCCTGGCTGGTGGCTGCTCTAGTGATAGTGATAAATGGCTATCTATTGCTGGAATTCTTCTCCTCTGAAGTGAATGGGGCAGTGTTTGCCACTGTAGTGTGTGTATTAACAGCTGCATATGTTGCATTTGTACTTTACCTTATTTCACGGGCCATTACCTATACACCGTGGCAAAGTTTAACCCGATCAAAGACAGCTACCACAGAGAGTTGA
Predicted protein sequences of Glyma11g05500
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma11g05500.1 sequence type=predicted peptide gene model=Glyma11g05500 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MPPEQTQQPLLSEEQEETAYDSSEKVVVVGIDDHDGDVEAPPFSWRKLWLFTGPGFLMSIAFLDPGNLEGDLQSGAIAGYSLLWLLMWATAMGLIIQLLSARLGVATGRHLAELCREEYPTWARIVLWLMTEIALIGADIQEVIGSAIAIRILSNGVVPLWAGVVITAFDCFIFLFLENYGVRKLEAFFAVLIGVMALSFAWMFGEAKPNGVDVLVGILVPKLSSRTIQQAVGVVGCIIMPHNVYLHSALVQSRQVDPSKKGRVQEALNYYSIESTIALIVSFVINIFVTTVFAKGFYGTEIANSIGLVNAGQYLQEKYGGGLFPILYIWGIGLLAAGQSSTITGTYAGQFIMGGFLNLRLKKWIRALITRSFAIIPTIIVALIFDTSEESLDVLNEWLNVLQSVQIPFALIPLLCLVSKEQIMGSFRIGPVLKIISWLVAALVIVINGYLLLEFFSSEVNGAVFATVVCVLTAAYVAFVLYLISRAITYTPWQSLTRSKTATTES*