SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma11g05500

Feature Type:gene_model
Chromosome:Gm11
Start:3834651
stop:3838333
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G23150AT Annotation by Michelle Graham. TAIR10: natural resistance-associated macrophage protein 3 | chr2:9856422-9858565 REVERSE LENGTH=509 SoyBaseE_val: 0ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006828GO-bp Annotation by Michelle Graham. GO Biological Process: manganese ion transport SoyBaseN/AISS
GO:0006875GO-bp Annotation by Michelle Graham. GO Biological Process: cellular metal ion homeostasis SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0010043GO-bp Annotation by Michelle Graham. GO Biological Process: response to zinc ion SoyBaseN/AISS
GO:0015691GO-bp Annotation by Michelle Graham. GO Biological Process: cadmium ion transport SoyBaseN/AISS
GO:0015692GO-bp Annotation by Michelle Graham. GO Biological Process: lead ion transport SoyBaseN/AISS
GO:0030001GO-bp Annotation by Michelle Graham. GO Biological Process: metal ion transport SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0055072GO-bp Annotation by Michelle Graham. GO Biological Process: iron ion homeostasis SoyBaseN/AISS
GO:2000379GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of reactive oxygen species metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0005384GO-mf Annotation by Michelle Graham. GO Molecular Function: manganese ion transmembrane transporter activity SoyBaseN/AISS
GO:0015103GO-mf Annotation by Michelle Graham. GO Molecular Function: inorganic anion transmembrane transporter activity SoyBaseN/AISS
GO:0046873GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion transmembrane transporter activity SoyBaseN/AISS
KOG1291 KOG Mn2+ and Fe2+ transporters of the NRAMP family JGI ISS
PTHR11706Panther MANGANESE TRANSPORTER JGI ISS
PTHR11706:SF8Panther NATURAL RESISTANCE-ASSOCIATED MACROPHAGE PROTEIN (NRAMP) (MANGANESE TRANSPORTER) JGI ISS
PF01566PFAM Natural resistance-associated macrophage protein JGI ISS
UniRef100_G7K3Y6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Natural resistance-associated macrophage protein n=1 Tax=Medicago truncatula RepID=G7K3Y6_MEDTR SoyBaseE_val: 0ISS
UniRef100_I1LH97UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LH97_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma01g39790 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g051500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g05500.1   sequence type=CDS   gene model=Glyma11g05500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTCCTGAACAGACCCAACAACCTCTGTTATCGGAGGAGCAAGAAGAGACAGCCTACGATTCCTCGGAGAAGGTGGTGGTGGTCGGAATCGACGACCACGACGGCGACGTGGAGGCGCCGCCGTTCTCATGGCGGAAGCTGTGGCTCTTCACTGGGCCCGGGTTTCTCATGAGCATCGCGTTTTTGGATCCCGGGAATCTCGAGGGGGATCTTCAGTCCGGTGCCATTGCTGGGTACTCGCTCTTGTGGCTCCTCATGTGGGCCACGGCTATGGGCCTTATCATCCAGCTTCTCTCGGCTCGGCTCGGCGTGGCTACGGGAAGGCACTTAGCCGAACTCTGCAGAGAAGAGTATCCCACATGGGCTAGGATTGTTCTGTGGTTGATGACTGAGATTGCTCTTATTGGCGCTGACATACAAGAGGTTATTGGGAGCGCTATTGCTATCAGGATTCTTAGTAACGGCGTCGTTCCACTCTGGGCTGGTGTCGTCATTACAGCTTTTGATTGTTTTATTTTTCTCTTTCTTGAGAACTACGGTGTGAGGAAACTGGAAGCGTTTTTCGCTGTTCTGATTGGTGTAATGGCTCTCTCATTTGCCTGGATGTTTGGTGAAGCCAAGCCCAATGGTGTTGATGTTCTTGTTGGTATTTTGGTTCCTAAACTTAGCTCCAGAACTATACAGCAAGCTGTTGGAGTTGTGGGTTGCATTATTATGCCTCACAATGTGTACTTGCATTCTGCGCTTGTTCAATCAAGGCAGGTTGATCCCAGCAAGAAAGGCCGTGTTCAGGAAGCTCTTAATTACTACTCCATAGAGTCCACCATTGCCCTTATAGTGTCCTTTGTCATTAATATATTTGTCACAACTGTGTTTGCTAAGGGCTTTTATGGTACTGAAATAGCAAATAGCATTGGTCTTGTAAATGCAGGGCAGTACCTTCAAGAGAAGTATGGGGGTGGACTATTCCCAATCCTGTATATATGGGGTATCGGGTTATTAGCAGCTGGCCAGAGTAGCACAATTACTGGTACATATGCTGGACAATTTATCATGGGGGGTTTTCTGAATTTAAGGTTGAAGAAGTGGATAAGGGCATTAATTACACGAAGTTTTGCAATCATCCCAACCATAATAGTTGCTCTTATATTTGATACCTCAGAGGAATCGTTAGATGTTCTGAATGAATGGCTTAATGTTCTCCAGTCAGTTCAAATCCCCTTTGCACTCATTCCCTTGCTTTGCTTGGTGTCCAAAGAACAGATAATGGGCAGTTTCAGAATTGGCCCTGTCCTCAAGATTATTTCCTGGCTGGTGGCTGCTCTAGTGATAGTGATAAATGGCTATCTATTGCTGGAATTCTTCTCCTCTGAAGTGAATGGGGCAGTGTTTGCCACTGTAGTGTGTGTATTAACAGCTGCATATGTTGCATTTGTACTTTACCTTATTTCACGGGCCATTACCTATACACCGTGGCAAAGTTTAACCCGATCAAAGACAGCTACCACAGAGAGTTGA

>Glyma11g05500.1   sequence type=predicted peptide   gene model=Glyma11g05500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPPEQTQQPLLSEEQEETAYDSSEKVVVVGIDDHDGDVEAPPFSWRKLWLFTGPGFLMSIAFLDPGNLEGDLQSGAIAGYSLLWLLMWATAMGLIIQLLSARLGVATGRHLAELCREEYPTWARIVLWLMTEIALIGADIQEVIGSAIAIRILSNGVVPLWAGVVITAFDCFIFLFLENYGVRKLEAFFAVLIGVMALSFAWMFGEAKPNGVDVLVGILVPKLSSRTIQQAVGVVGCIIMPHNVYLHSALVQSRQVDPSKKGRVQEALNYYSIESTIALIVSFVINIFVTTVFAKGFYGTEIANSIGLVNAGQYLQEKYGGGLFPILYIWGIGLLAAGQSSTITGTYAGQFIMGGFLNLRLKKWIRALITRSFAIIPTIIVALIFDTSEESLDVLNEWLNVLQSVQIPFALIPLLCLVSKEQIMGSFRIGPVLKIISWLVAALVIVINGYLLLEFFSSEVNGAVFATVVCVLTAAYVAFVLYLISRAITYTPWQSLTRSKTATTES*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo