SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g05080): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g05080): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g05080

Feature Type:gene_model
Chromosome:Gm11
Start:3533012
stop:3536292
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G49870AT Annotation by Michelle Graham. TAIR10: ADP-ribosylation factor-like A1C | chr3:18492674-18494021 REVERSE LENGTH=184 SoyBaseE_val: 6.00E-125ISS
GO:0006661GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process SoyBaseN/AISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0009741GO-bp Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus SoyBaseN/AISS
GO:0051607GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to virus SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG0075 KOG GTP-binding ADP-ribosylation factor-like protein JGI ISS
PTHR11711Panther ARF-RELATED JGI ISS
PTHR11711:SF20Panther ADP-RIBOSYLATION FACTOR-RELATED JGI ISS
PF00025PFAM ADP-ribosylation factor family JGI ISS
UniRef100_G7K2H2UniRef Annotation by Michelle Graham. Best UniRef hit: ADP-RIBOSYLATION FACTOR-like protein n=1 Tax=Medicago truncatula RepID=G7K2H2_MEDTR SoyBaseE_val: 3.00E-131ISS
UniRef100_G7K2H2UniRef Annotation by Michelle Graham. Most informative UniRef hit: ADP-RIBOSYLATION FACTOR-like protein n=1 Tax=Medicago truncatula RepID=G7K2H2_MEDTR SoyBaseE_val: 3.00E-131ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g05080 not represented in the dataset

Glyma11g05080 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma01g40210 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g047400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g05080.1   sequence type=CDS   gene model=Glyma11g05080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGATTGTGGGAAGCTTTTCTCAATTGGCTTCGCAGCCTTTTTTTCAAGCAGGAAATGGAGTTATCTCTAATAGGACTTCAGAATGCTGGGAAGACTTCCCTTGTAAATGTAGTTGCTACCGGTGGATATAGTGAGGACATGATTCCAACTGTGGGATTCAATATGAGGAAAGTGACAAAAGGGAATGTTACAATAAAGTTATGGGATCTTGGAGGGCAACCTAGGTTCCGCAGCATGTGGGAACGTTACTGTCGTGCCGTTTCTGCTATTGTTTATGTTGTTGATGCTGCCGATCCAGATAACCTTAGCATATCAAGAAGTGAGCTTCATGATTTGCTGAGCAAACCATCATTGGGTGGCATCCCTCTGTTGGTATTGGGGAACAAGATTGACAAAGCGGGGGCTCTGTCTAAACAAGCATTGACTGACCAAATGGATTTGAAGTCAATTACTGACAGGGAAGTTTGCTGCTTCATGATCTCGTGCAAAAACTCGACCAACATCGACTCTGTTATTGACTGGCTTGTAAAGCATTCCAAATCAAAGAGCTGA

>Glyma11g05080.1   sequence type=predicted peptide   gene model=Glyma11g05080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLWEAFLNWLRSLFFKQEMELSLIGLQNAGKTSLVNVVATGGYSEDMIPTVGFNMRKVTKGNVTIKLWDLGGQPRFRSMWERYCRAVSAIVYVVDAADPDNLSISRSELHDLLSKPSLGGIPLLVLGNKIDKAGALSKQALTDQMDLKSITDREVCCFMISCKNSTNIDSVIDWLVKHSKSKS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo