SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g05000

Feature Type:gene_model
Chromosome:Gm11
Start:3483829
stop:3485228
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g05000
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G67640AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). | chr5:26969546-26970548 REVERSE LENGTH=201 SoyBaseE_val: 8.00E-11ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1LH48UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LH48_SOYBN SoyBaseE_val: 1.00E-111ISS

Expression Patterns of Glyma11g05000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g05000
ParalogEvidenceComments
Glyma01g40280 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g05000 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g046600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g05000
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g05000
>Glyma11g05000.1   sequence type=CDS   gene model=Glyma11g05000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACCCAGATGACAGAAAACGAAGGTTCAATGAAGCCATCGTTAATATGCTCTATCCCTCTCCTGAGTCTCCTCCTCTACCGCAACGCGAACAGGAGTTGAAACCTGTGGAAACAGCTTTGATCGACGACGGGTCTCGTTTTGACATTATTTCAGGCAATTTGGACGATTACGACAATGCCTCCACGAGCGGCAACGAAGAACATGACTCCCAGACGACGGAGAAGCTCACGAGGGCTCAACGAAAGAAAATCCGTAAGAAGAAGCTGAAGGAAGAAGCGATACATCGCGGAAAATTAATTGGGCCATTGTTGCCTCTCACCCCCACTCAAGTTCCAGAGGATGCTCCAACTGTTCGATCAAATGCTCCTGAAGAAGGTGATGAAGATGTGGGGGCTTGTGCTAAATCCGTGAAAGTGAAGCACCGGAGGATGGCAAAAAGGCTCGCCAAAGAAAAGCAAAATGCCTCTATTTCGTAG
Predicted protein sequences of Glyma11g05000
>Glyma11g05000.1   sequence type=predicted peptide   gene model=Glyma11g05000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNPDDRKRRFNEAIVNMLYPSPESPPLPQREQELKPVETALIDDGSRFDIISGNLDDYDNASTSGNEEHDSQTTEKLTRAQRKKIRKKKLKEEAIHRGKLIGPLLPLTPTQVPEDAPTVRSNAPEEGDEDVGACAKSVKVKHRRMAKRLAKEKQNASIS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo