SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g04970): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g04970): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g04970

Feature Type:gene_model
Chromosome:Gm11
Start:3459788
stop:3460731
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g04970
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G22880AT Annotation by Michelle Graham. TAIR10: VQ motif-containing protein | chr2:9741119-9741463 REVERSE LENGTH=114 SoyBaseE_val: 9.00E-11ISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF05678PFAM VQ motif JGI ISS
UniRef100_D7LE53UniRef Annotation by Michelle Graham. Most informative UniRef hit: VQ motif-containing protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LE53_ARALL SoyBaseE_val: 1.00E-07ISS
UniRef100_I1LH46UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LH46_SOYBN SoyBaseE_val: 3.00E-108ISS

Expression Patterns of Glyma11g04970
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g04970 not represented in the dataset
Glyma11g04970 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g04970
ParalogEvidenceComments
Glyma01g40320 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g04970 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g046400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g04970
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g04970
>Glyma11g04970.1   sequence type=CDS   gene model=Glyma11g04970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGCTTATTATTCCGGTTCTTACCCTGCGTCGACCAAGCCTATTTCTCTGCTTCACACCGTGCGGAAGGTACAAGCAAAACCGTGGAAGAAGGCGGCAGTGGCGCCACCGGCACCGACACCGATCAGAGTGTACAAGGTGGACGCTATCAACTTCCGTGACCTTGTTCAGCAGCTTACCGGTGCACCCGAGTTCAAGCCAGCTGATCAGGAACAACATCAACTTTTCCCAAGTGTCGCACCTATTGCTGCCACCTTTGTAGATACGCCCCAAAAGCCAATGTTGTCGAGCAAAGACAATATTGCAGCATCATCGACAGTGTCCTCGGCCACTAATTGGTACCAGGGGGCAAAATCTGAACCATTGGAAATGAATTTATCATCACCCTCTTCTTATAACTGGTTTTTTGTCCCTCCTATCAGCCAAGGAAACATGACCAGCTTGGAACCGGGGAGGGTTCTCTAG
Predicted protein sequences of Glyma11g04970
>Glyma11g04970.1   sequence type=predicted peptide   gene model=Glyma11g04970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEAYYSGSYPASTKPISLLHTVRKVQAKPWKKAAVAPPAPTPIRVYKVDAINFRDLVQQLTGAPEFKPADQEQHQLFPSVAPIAATFVDTPQKPMLSSKDNIAASSTVSSATNWYQGAKSEPLEMNLSSPSSYNWFFVPPISQGNMTSLEPGRVL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo