SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g04590

Feature Type:gene_model
Chromosome:Gm11
Start:3118105
stop:3120202
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g04590
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G17960AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G46620.1); Has 46 Blast hits to 45 proteins in 13 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 46; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr4:9971154-9972227 FORWARD LENGTH=154 SoyBaseE_val: 5.00E-29ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6TBD6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TBD6_SOYBN SoyBaseE_val: 3.00E-91ISS

Expression Patterns of Glyma11g04590
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g04590
ParalogEvidenceComments
Glyma01g40710 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g04590 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g042700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g04590
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g04590
>Glyma11g04590.1   sequence type=CDS   gene model=Glyma11g04590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGATTCTTCAAAAGGGTAGCTGGATTTCTTGGGTTTGGAAACCACAAACACGATTCCAAGGATGAGACCGACGACGGTCAACCTCGAGTGAGAGAAACCGTCGTCGATCGCCCCCACCTCGCTCCCGTTCTCACTCCCTCTACTTCCGGCGACGGCGGAATTCAGGGTCTGGATTGGTATGTAAATCATCTTAGGATGGATGAAGATGGTGATTTAGCAGATCAGTTCCTTGATGAGGTTTCATCAGAGAAGCCAGAAGGAGTTGCAGTAGATCATCATAAAACACAAGCAAGGTTTAAACTGAAGAATGGGACCAAGTCAGTCAGAGTGAAGAAACCGATCCTATTAGGTGGGAAAATTATTCCACAGATTGTGGAATCCCACCAGGGCAGATTGTAG
Predicted protein sequences of Glyma11g04590
>Glyma11g04590.1   sequence type=predicted peptide   gene model=Glyma11g04590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGFFKRVAGFLGFGNHKHDSKDETDDGQPRVRETVVDRPHLAPVLTPSTSGDGGIQGLDWYVNHLRMDEDGDLADQFLDEVSSEKPEGVAVDHHKTQARFKLKNGTKSVRVKKPILLGGKIIPQIVESHQGRL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo