SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g04420

Feature Type:gene_model
Chromosome:Gm11
Start:2987591
stop:2990156
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g04420
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G32410AT Annotation by Michelle Graham. TAIR10: Vacuolar protein sorting 55 (VPS55) family protein | chr1:11694398-11695297 FORWARD LENGTH=140 SoyBaseE_val: 9.00E-62ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
KOG2174 KOG Leptin receptor gene-related protein JGI ISS
PTHR12050Panther LEPTIN RECEPTOR-RELATED JGI ISS
PF04133PFAM Vacuolar protein sorting 55 JGI ISS
UniRef100_B9SRZ4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transporter, putative n=1 Tax=Ricinus communis RepID=B9SRZ4_RICCO SoyBaseE_val: 4.00E-72ISS
UniRef100_C6SYE8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SYE8_SOYBN SoyBaseE_val: 5.00E-92ISS

Expression Patterns of Glyma11g04420
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g04420
ParalogEvidenceComments
Glyma01g40930 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g04420 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g041100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g04420
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g04420
>Glyma11g04420.1   sequence type=CDS   gene model=Glyma11g04420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGACTTACCAGGGTATCTTCATGCCTGTTTGAACACAGGGAAGCTTGCCTCCTTGGCAATTTTGGTGTCTGGAGGAATCGTCTTGCAAATTTTGGCATGTGCCTTGTATAATAACTGGTGGCCGATGCTGAGTGTGTTAACGTATGTGCTTCTTCCAATGCCTTTGCTGTTCTTTGCGGGGTCTGATGATTCTATATTTTCTGAATCTGATAATAGCTGGGTAAATTTTACTAAGTTCTTGACTGGAGCCTCAACTGTGGGAGGCATTGCCATTCCAAGCATATTAAAGCATGCTGGGGTTATCGGTTGGGGAGCCTTTGCAATGGAACTCTCTTCCTACTTTGTGTTTGGAATGGCCGTAATATGTTACCTTTGGATGAGTGGTGATGATGATTACAGTATCCTATGA
Predicted protein sequences of Glyma11g04420
>Glyma11g04420.1   sequence type=predicted peptide   gene model=Glyma11g04420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADLPGYLHACLNTGKLASLAILVSGGIVLQILACALYNNWWPMLSVLTYVLLPMPLLFFAGSDDSIFSESDNSWVNFTKFLTGASTVGGIAIPSILKHAGVIGWGAFAMELSSYFVFGMAVICYLWMSGDDDYSIL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo