SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g04360

Feature Type:gene_model
Chromosome:Gm11
Start:2971996
stop:2973935
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g04360
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G45760AT Annotation by Michelle Graham. TAIR10: BON association protein 2 | chr2:18847125-18847748 REVERSE LENGTH=207 SoyBaseE_val: 1.00E-34ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009693GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF00168PFAM C2 domain JGI ISS
UniRef100_H9DXV8UniRef Annotation by Michelle Graham. Most informative UniRef hit: BAP1 n=1 Tax=Vitis vinifera RepID=H9DXV8_VITVI SoyBaseE_val: 4.00E-42ISS
UniRef100_I1LGX6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LGX6_SOYBN SoyBaseE_val: 2.00E-125ISS

Expression Patterns of Glyma11g04360
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g04360
ParalogEvidenceComments
Glyma01g41070 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g04360 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g040600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g04360
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g04360
>Glyma11g04360.1   sequence type=CDS   gene model=Glyma11g04360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAAGAACTGTAGAGATGACGATTCTGTCAGCAGAAAACCTCCAAATGAATAGAAAATCCATTAGAGGGAGTACATTTGTGACGGTTCAATCCGACGCTAGTAGCGATGACACAAGTGCTGCCACGAAAGTGGATTTAGAGGGTGGAAGTTACCCTTCGTGGAATGAGAAAGTTGTGATGGACGTGCCATTGCATGCAAGGTTCATAACCGTTGAAGTGAAGTGCAAAACGTCTTCATCAGGGTCTAACAGTGTTGGCGTGGCACAAATACCGGTTTCTGATTTCATTGGAGGCTATATGCCCGAAAATCAATTGCATTTCTTGAGCTATAGGTTGTGGGACGGTAAAGTTAGGAGAAATGGGGTTATAAACATTTCGGTGAGGGTGAAAGTGGCAGAACATTCTTCTTGTAATTTGAATTCTATGTCATTGTCTGCGGTAACCGGGGTGCCGGTGGCCGGTGATGGCTCCTCTGGAGTTGTCACAGGGATTCCAGCTGTTTGGGTAAACTACCAAAGAAATCATTGA
Predicted protein sequences of Glyma11g04360
>Glyma11g04360.1   sequence type=predicted peptide   gene model=Glyma11g04360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSRTVEMTILSAENLQMNRKSIRGSTFVTVQSDASSDDTSAATKVDLEGGSYPSWNEKVVMDVPLHARFITVEVKCKTSSSGSNSVGVAQIPVSDFIGGYMPENQLHFLSYRLWDGKVRRNGVINISVRVKVAEHSSCNLNSMSLSAVTGVPVAGDGSSGVVTGIPAVWVNYQRNH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo