SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g04250

Feature Type:gene_model
Chromosome:Gm11
Start:2849651
stop:2851414
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g04250
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G47060AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF581) | chr5:19116843-19117639 FORWARD LENGTH=177 SoyBaseE_val: 1.00E-40ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF04570PFAM Protein of unknown function (DUF581) JGI ISS
UniRef100_A5Z1R3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ethphon-induced protein n=1 Tax=Hevea brasiliensis RepID=A5Z1R3_HEVBR SoyBaseE_val: 8.00E-22ISS
UniRef100_C6T5P4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T5P4_SOYBN SoyBaseE_val: 1.00E-114ISS

Expression Patterns of Glyma11g04250
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g04250
ParalogEvidenceComments
Glyma01g41170 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g04250 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g039800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g04250
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g04250
>Glyma11g04250.1   sequence type=CDS   gene model=Glyma11g04250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGGTGGTTCTATCAAGAGACATTCTTTCTCCGAAGAGGACCATGGTTTCGCTTCTTCCATGGAGCCTGGGTATTCTGGGCACAACCACCACTTCCATCATGGTTTCGTGTCTAGGACTTTGGGTTATGGCACTTTCTACAACCGAGGTGTTAGGAGCCATTCGATTTTCTCGCCGAGATCTGGGAGATTTTATGATGCAAGATTCGAAGATCACCAACCCCACTTTCTTCAAGCTTGTTCTCTTTGCAAGAAGCGTCTCGGGGATAATAGTGACATCTTCATGTACAAAGGGGACACGCCTTTTTGCAGCGAAGAGTGTAGACAAGAGCAAATGGAGAGAGACGAAGCCAAGGAGAAGAATAATAACCTTTCTTCTTCGATGAAGGCTTTGAGAAAAAAAGAGCAAAGAAATTCTGTCTCCCCAAACAAGACCCAAGATTACTCATTTCGTGCAGGGACGGTTGCTGCTGCTTAG
Predicted protein sequences of Glyma11g04250
>Glyma11g04250.1   sequence type=predicted peptide   gene model=Glyma11g04250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGGSIKRHSFSEEDHGFASSMEPGYSGHNHHFHHGFVSRTLGYGTFYNRGVRSHSIFSPRSGRFYDARFEDHQPHFLQACSLCKKRLGDNSDIFMYKGDTPFCSEECRQEQMERDEAKEKNNNLSSSMKALRKKEQRNSVSPNKTQDYSFRAGTVAAA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo