Glyma11g03821 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g03821): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g03821): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g03821

Feature Type:	gene_model
Chromosome:	Gm11
Start:	2557858
stop:	2558676
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g03821

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G16765	AT	Annotation by Michelle Graham. TAIR10: 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein \| chr4:9429974-9431791 REVERSE LENGTH=247	SoyBase	E_val: 5.00E-15	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005506	GO-mf	Annotation by Michelle Graham. GO Molecular Function: iron ion binding	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0016706	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors	SoyBase	N/A	ISS
PTHR10209	Panther	FE(II)/ ASCORBATE OXIDASE SUPERFAMILY	JGI		ISS
PF03171	PFAM	2OG-Fe(II) oxygenase superfamily	JGI		ISS
UniRef100_G7JHQ2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Flavonol synthase/flavanone 3-hydroxylase n=1 Tax=Medicago truncatula RepID=G7JHQ2_MEDTR	SoyBase	E_val: 1.00E-13	ISS
UniRef100_UPI000189D8AB	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000189D8AB related cluster n=1 Tax=unknown RepID=UPI000189D8AB	SoyBase	E_val: 3.00E-16	ISS

Expression Patterns of Glyma11g03821

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g03821 not represented in the dataset	Glyma11g03821 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g03821 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g035500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g03821

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g03821

Limit To All Plant Sequences

>Glyma11g03821.1   sequence type=CDS   gene model=Glyma11g03821   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTTCATTAGTTTGCATCTTCAGGGCCTTTATTGTGAACATCGGTGACTTGATGGAGAGGTGGACTAATTGTTTATATCGGTCAACAATGCATCGGGTTAAACAAACTGGCAAAGAACGCTATTCGGTAATTATAAGCTACTTTTCTCAGTCGCTTCATTTTGTCATATTTGTTCCATTAACTTTTTCGAATCATAGTTTATGA

Predicted protein sequences of Glyma11g03821

Limit To All Plant Sequences

>Glyma11g03821.1   sequence type=predicted peptide   gene model=Glyma11g03821   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFSLVCIFRAFIVNIGDLMERWTNCLYRSTMHRVKQTGKERYSVIISYFSQSLHFVIFVPLTFSNHSL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain