Glyma11g03770 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g03770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g03770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g03770

Feature Type:	gene_model
Chromosome:	Gm11
Start:	2522884
stop:	2524267
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g03770

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G14750	AT	Annotation by Michelle Graham. TAIR10: myb domain protein 66 \| chr5:4763656-4764738 REVERSE LENGTH=203	SoyBase	E_val: 4.00E-49	ISS
GO:0001708	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell fate specification	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009913	GO-bp	Annotation by Michelle Graham. GO Biological Process: epidermal cell differentiation	SoyBase	N/A	ISS
GO:0045165	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell fate commitment	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0048765	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
KOG0048	KOG	Transcription factor, Myb superfamily	JGI		ISS
PTHR10641	Panther	MYB-RELATED	JGI		ISS
PF00249	PFAM	Myb-like DNA-binding domain	JGI		ISS
UniRef100_C0A1G8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: R2R3-MYB transcription factor LjPAP n=1 Tax=Lotus japonicus RepID=C0A1G8_LOTJA	SoyBase	E_val: 9.00E-85	ISS
UniRef100_UPI000233CB66	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233CB66 related cluster n=1 Tax=unknown RepID=UPI000233CB66	SoyBase	E_val: 2.00E-132	ISS

Expression Patterns of Glyma11g03770

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g03770 not represented in the dataset	Glyma11g03770 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g03770

Paralog	Evidence	Comments
Glyma01g41610	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g03770 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g034900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g03770

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g03770

Limit To All Plant Sequences

>Glyma11g03770.2   sequence type=CDS   gene model=Glyma11g03770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACCCCCGAGGAATGTTGAAACTGCTAAGAAAACAAACAACAGAGGAGCATGGACCGCGGAGGAAGATCAGAAGCTAGCCCAGTGCATTGAAATTCACGGTGCAAAGAAATGGAAAACTGTTGCAATTAAATCAGGTCTAAACAGATGTGGAAAAAGTTGCAGGCTGAGATGGTTAAACTATTTGAGACCAAATATCAAGAGGGGCAACATATCAGTTGAGGAAGAGGATTTGATTATTAGGCTTCACAAACTGCTGGGAAACAGGTGGTCATTGATAGCTAAGAGACTTCCAGGACGAACAGACAATGAAATTAAGAACTACTGGAATACTTGTTTGTGCAAAAAAGTTAATCACAAAAAGGTGAAACCTGAAACTTCAACGGCACAAACAACGCATACGACTCAGAATACCGAGGAAAGAGCAGCGGTAGAGAATAAAGAGGGCACTGATGATGGGAGTGGGGACTCAGAAGTTAACTTTGATGTGAACGAATTCTTCAACTTCTCCATTGAATCTGGACCCTTTGCGTTGGATTGGATGATCTAA

Predicted protein sequences of Glyma11g03770

Limit To All Plant Sequences

>Glyma11g03770.2   sequence type=predicted peptide   gene model=Glyma11g03770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPPRNVETAKKTNNRGAWTAEEDQKLAQCIEIHGAKKWKTVAIKSGLNRCGKSCRLRWLNYLRPNIKRGNISVEEEDLIIRLHKLLGNRWSLIAKRLPGRTDNEIKNYWNTCLCKKVNHKKVKPETSTAQTTHTTQNTEERAAVENKEGTDDGSGDSEVNFDVNEFFNFSIESGPFALDWMI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain