SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g03180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g03180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g03180

Feature Type:gene_model
Chromosome:Gm11
Start:2104263
stop:2105580
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g03180
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G12340AT Annotation by Michelle Graham. TAIR10: Cornichon family protein | chr1:4197396-4198032 FORWARD LENGTH=129 SoyBaseE_val: 2.00E-51ISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG2729 KOG ER vesicle integral membrane protein involved in establishing cell polarity, signaling and protein degradation JGI ISS
PTHR12290Panther CORNICHON JGI ISS
PTHR12290:SF5Panther CORNICHON-RELATED JGI ISS
PF03311PFAM Cornichon protein JGI ISS
UniRef100_G7JK78UniRef Annotation by Michelle Graham. Most informative UniRef hit: ER-derived vesicles protein ERV14 n=1 Tax=Medicago truncatula RepID=G7JK78_MEDTR SoyBaseE_val: 2.00E-53ISS
UniRef100_UPI000233D85DUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D85D related cluster n=1 Tax=unknown RepID=UPI000233D85D SoyBaseE_val: 1.00E-72ISS

Expression Patterns of Glyma11g03180
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g03180 not represented in the dataset
Glyma11g03180 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g03180
ParalogEvidenceComments
Glyma01g42190 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g03180 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g029100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g03180
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g03180
>Glyma11g03180.2   sequence type=CDS   gene model=Glyma11g03180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTATTGTGCCTGGCAGACCTAGAATTTGATTATATAAATCCTTATGACTCCTCAGCTCGAATAAATATGGTGGTTTTGCCAGAATATATTACGCAAGCTGTCCTGTGCTGCTTCTACCTTCTTACCAAGCATTGGATTCTGGCACTCTTCTTTCTTCCTTATCTTTTTCACAATGTCCGATTGTATAGACAAGGAAGGCATTTGGTTGATGTTACTGAGATATTCAACCTGCTCACTTGGGAAAAGAAGCAAAGGCTTGTCAAACTCTTCTATCTTGTTTTTACCCTTTTCCTCTCTGTATTTTGGATGATTTACACATCATTGGATTAG
Predicted protein sequences of Glyma11g03180
>Glyma11g03180.2   sequence type=predicted peptide   gene model=Glyma11g03180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LLCLADLEFDYINPYDSSARINMVVLPEYITQAVLCCFYLLTKHWILALFFLPYLFHNVRLYRQGRHLVDVTEIFNLLTWEKKQRLVKLFYLVFTLFLSVFWMIYTSLD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo