SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g02765): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g02765): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g02765

Feature Type:gene_model
Chromosome:Gm11
Start:1791030
stop:1796729
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g02765
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G52230AT Annotation by Michelle Graham. TAIR10: methyl-CPG-binding domain protein 13 | chr5:21208097-21211634 REVERSE LENGTH=746 SoyBaseE_val: 6.00E-13ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0008327GO-mf Annotation by Michelle Graham. GO Molecular Function: methyl-CpG binding SoyBaseN/AISS
PF01429PFAM Methyl-CpG binding domain JGI ISS
UniRef100_B9ID48UniRef Annotation by Michelle Graham. Most informative UniRef hit: Methyl binding domain protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9ID48_POPTR SoyBaseE_val: 9.00E-13ISS
UniRef100_B9RC70UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RC70_RICCO SoyBaseE_val: 3.00E-29ISS

Expression Patterns of Glyma11g02765
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g02765 not represented in the dataset
Glyma11g02765 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g02765 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g025500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g02765
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g02765
>Glyma11g02765.1   sequence type=CDS   gene model=Glyma11g02765   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTCATGGGTATAAGTGTTACATTGCTCCAAGTGGACACAAATTCTACTCCAAACCAGAGGTGTTACGATATCTCGATACTGTAAACATAAACAGCAACAGCCACACTTCCAAGAAGGAAAAGATATGCAAAAGCAATGATACAGTTGAGAAGTCCACCATAGAGGATTTACCACCTGGTCAGATTAAAGAAGTCAAGATTAGGAAGGGCAGTAACGACAACAGGGATGTGGTTGAGAAGTCTCCAGTGGAGGATTTACCACCTGGGTGGATAACAGAAGCCAAGGTTAGGAAGGGTGATACTGGCAATAGGAAAGATATGTTTTATATAGATCCAGTGAGTGGATATGTATTTCGCTCCAAGAAGGATGCACTGCGCTATGTTAAGTCTGGAGATATAAGTACGTGTGTACTTAAACCATATAAAAAACTAATCCAAGATGAAGACAAAATAACTGTAAGGATTCTCTGCTTAATATGA
Predicted protein sequences of Glyma11g02765
>Glyma11g02765.1   sequence type=predicted peptide   gene model=Glyma11g02765   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGHGYKCYIAPSGHKFYSKPEVLRYLDTVNINSNSHTSKKEKICKSNDTVEKSTIEDLPPGQIKEVKIRKGSNDNRDVVEKSPVEDLPPGWITEAKVRKGDTGNRKDMFYIDPVSGYVFRSKKDALRYVKSGDISTCVLKPYKKLIQDEDKITVRILCLI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo