SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g02380): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g02380): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g02380

Feature Type:gene_model
Chromosome:Gm11
Start:1507425
stop:1510083
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G63970AT Annotation by Michelle Graham. TAIR10: isoprenoid F | chr1:23738923-23740336 REVERSE LENGTH=231 SoyBaseE_val: 2.00E-105ISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0006655GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process SoyBaseN/AISS
GO:0006744GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquinone biosynthetic process SoyBaseN/AISS
GO:0009073GO-bp Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family biosynthetic process SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010155GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of proton transport SoyBaseN/AISS
GO:0010218GO-bp Annotation by Michelle Graham. GO Biological Process: response to far red light SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016114GO-bp Annotation by Michelle Graham. GO Biological Process: terpenoid biosynthetic process SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0008685GO-mf Annotation by Michelle Graham. GO Molecular Function: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity SoyBaseN/AISS
PF02542PFAM YgbB family JGI ISS
UniRef100_C6SZ46UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZ46_SOYBN SoyBaseE_val: 2.00E-162ISS
UniRef100_G7KC04UniRef Annotation by Michelle Graham. Most informative UniRef hit: 2-C-methyl-D-erythritol 2 4-cyclodiphosphate synthase n=1 Tax=Medicago truncatula RepID=G7KC04_MEDTR SoyBaseE_val: 1.00E-129ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g02380 not represented in the dataset

Glyma11g02380 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g021400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g02380.1   sequence type=CDS   gene model=Glyma11g02380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCTTCTTCCTTTACAACATCTTCCATTCTCTTCCCATTCACAACTAGTTCTAAATCCCCTCCTTCTCAACTATTCCCCTCTTTTCCTTGCAAACATCATACCCTCCGTCTCAGACCCGTCTCAGTCTCAGCCGCTTCAACCCCAACCCCCTCCATCCAAGCCGACAAATCCCCGGTCTCCGCCACTCCCTCCAAGCTTCTCCCCTTTCGGATTGGTCACGGCTTTGACCTCCACCGATTGGAACCCGGTTATCCCCTAATCATCGGTGGAATCAACATTCCCCACGATAGAGGTTGCGAGGCTCATTCCGATGGTGACGTTCTGCTTCACTGCGTTGTTGATGCGATTCTAGGGGCGCTAGGTCTTCCTGATATTGGCCAGATTTTCCCCGATTCTGATCCTAAGTGGAAGGGTTGTGCCTCTTCCGTCTTCATCCATGAATCTGTGAGACTTATGCATGAGGCTGGTTATGAGATTGGGAATTTAGATGCTACATTGATACTTCAGAGGCCAAAACTAAGCCCACACAAGGATGCTATCAAGGCCAACTTATCTGCACTGCTTGGGGTGGACTCTTCTGTAGTAAATATCAAAGCAAAAACTCATGAAAAGGTAGACAGCCTTGGAGAAAATAGAAGTATAGCGGCTCACACAGTGGTTCTTCTAATGAAGAAATGA

>Glyma11g02380.1   sequence type=predicted peptide   gene model=Glyma11g02380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAASSFTTSSILFPFTTSSKSPPSQLFPSFPCKHHTLRLRPVSVSAASTPTPSIQADKSPVSATPSKLLPFRIGHGFDLHRLEPGYPLIIGGINIPHDRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGCASSVFIHESVRLMHEAGYEIGNLDATLILQRPKLSPHKDAIKANLSALLGVDSSVVNIKAKTHEKVDSLGENRSIAAHTVVLLMKK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo