SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g02061

Feature Type:gene_model
Chromosome:Gm11
Start:1267353
stop:1270781
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g02061
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G46410AT Annotation by Michelle Graham. TAIR10: Homeodomain-like superfamily protein | chr2:19049315-19050185 REVERSE LENGTH=94 SoyBaseE_val: 2.00E-27ISS
GO:0001708GO-bp Annotation by Michelle Graham. GO Biological Process: cell fate specification SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009888GO-bp Annotation by Michelle Graham. GO Biological Process: tissue development SoyBaseN/AISS
GO:0009913GO-bp Annotation by Michelle Graham. GO Biological Process: epidermal cell differentiation SoyBaseN/AISS
GO:0010063GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of trichoblast fate specification SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
UniRef100_E4W697UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor MYB363 n=1 Tax=Glycine max RepID=E4W697_SOYBN SoyBaseE_val: 6.00E-43ISS
UniRef100_I1LG96UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LG96_SOYBN SoyBaseE_val: 8.00E-49ISS

Expression Patterns of Glyma11g02061
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g02061 not represented in the dataset
Glyma11g02061 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g02061
ParalogEvidenceComments
Glyma01g43435 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g02061 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g018200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g02061
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g02061
>Glyma11g02061.1   sequence type=CDS   gene model=Glyma11g02061   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTATCCACCAAGCAGTCATTTTTTAAAGTACTGTGTGCAATTATATGGTACCTATAAGTTCTCCCATGTTTCCGCACTAGCTTTGAGAACAAATTATCTTGAATTCCTTGTTTGTATCATTTCATCAGCAGAAGAGAATGCAAAGATGTCCACCACCGCAACTACAACCTCTGAAGAAGTTAGCAGCAATGAGTGGAAAGTCATACACATGAGCGAGCAAGAGGAGGATCTCATTCGCAGGATGTACAAGCTAGTCGGGGACAAGTGGAATTTGATAGCCGGTCGCATTCCCAGTCGTAAAGCAGAAGAAATAGAGAGATTCTGGATTATGAGACACGGTGATGCTTTCTCTGTTAAAAGACACAGAAGTAAAGCCCAAGACTCATGA
Predicted protein sequences of Glyma11g02061
>Glyma11g02061.1   sequence type=predicted peptide   gene model=Glyma11g02061   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYPPSSHFLKYCVQLYGTYKFSHVSALALRTNYLEFLVCIISSAEENAKMSTTATTTSEEVSSNEWKVIHMSEQEEDLIRRMYKLVGDKWNLIAGRIPSRKAEEIERFWIMRHGDAFSVKRHRSKAQDS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo