Glyma11g01911 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g01911

Feature Type:	gene_model
Chromosome:	Gm11
Start:	1152482
stop:	1153495
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g01911

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G23930	AT	Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family \| chr4:12436131-12436694 REVERSE LENGTH=187	SoyBase	E_val: 2.00E-65	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF03168	PFAM	Late embryogenesis abundant protein	JGI		ISS
UniRef100_I1LG70	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LG70_SOYBN	SoyBase	E_val: 2.00E-126	ISS
UniRef100_Q9T0A8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Late embryogenesis abundant hydroxyproline-rich glycoprotein n=1 Tax=Arabidopsis thaliana RepID=Q9T0A8_ARATH	SoyBase	E_val: 1.00E-62	ISS

Expression Patterns of Glyma11g01911

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g01911 not represented in the dataset	Glyma11g01911 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g01911

Paralog	Evidence	Comments
Glyma01g43570	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g01911 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g016700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g01911

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g01911

Limit To All Plant Sequences

>Glyma11g01911.1   sequence type=CDS   gene model=Glyma11g01911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGAAGCCCGAGAGCCGCACCAACTTGGCTTCGTGTTTCGTTGCCACCATTTTCTTGATCTTTCTTCTCATTGTCGTCTTCATCGTTTACTTCACTGTGTTCAAGCCGCAGGACCCCAAAATCGCTGTGAGCGCCGTCCAGATCCCTTCCTTCTCCGCGACTAACGGCACCGTCAACTTCACGTTCTCACAGTACGCCTCCGTTAGGAACCCTAACCGAGGCACGTTCTCGCACTACGACAGCTCGCTCCAGCTTCTCTACTACGGCAGACAGGTCGGCTTCATGTTCGTTCCCGCCGGCAGGACTCAGTACATGGCCGCCACCTTCACCGTCCAGTCCTTCCCCTTGGGCCTCGGTCCCCCCTTCGTTGATGGGCCCAGTAATGTGGGGCCCACGATGGAGATCGAGTCGAGGATTGAGATGGCGGGGCGCGTGAGGGTGTTGCACCTCTTCAGTCGTCACGTGGAGGCCAAAGCTCAATGCAGGGTCGCCATCGCCATCACCGATGGATCCGTATTAGGTTTTCGGTGCTAA

Predicted protein sequences of Glyma11g01911

Limit To All Plant Sequences

>Glyma11g01911.1   sequence type=predicted peptide   gene model=Glyma11g01911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKPESRTNLASCFVATIFLIFLLIVVFIVYFTVFKPQDPKIAVSAVQIPSFSATNGTVNFTFSQYASVRNPNRGTFSHYDSSLQLLYYGRQVGFMFVPAGRTQYMAATFTVQSFPLGLGPPFVDGPSNVGPTMEIESRIEMAGRVRVLHLFSRHVEAKAQCRVAIAITDGSVLGFRC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain