Glyma11g01881 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g01881): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g01881): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g01881

Feature Type:	gene_model
Chromosome:	Gm11
Start:	1147260
stop:	1147642
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g01881

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G10950	AT	Annotation by Michelle Graham. TAIR10: SGNH hydrolase-type esterase superfamily protein \| chr4:6711502-6713512 REVERSE LENGTH=400	SoyBase	E_val: 2.00E-45	ISS
GO:0006629	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid metabolic process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0016788	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds	SoyBase	N/A	ISS
UniRef100_B9RCU4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger protein, putative n=1 Tax=Ricinus communis RepID=B9RCU4_RICCO	SoyBase	E_val: 1.00E-44	ISS
UniRef100_UPI000233C6E4	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233C6E4 related cluster n=1 Tax=unknown RepID=UPI000233C6E4	SoyBase	E_val: 3.00E-62	ISS

Expression Patterns of Glyma11g01881

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g01881 not represented in the dataset	Glyma11g01881 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g01881 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g016400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g01881

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g01881

Limit To All Plant Sequences

>Glyma11g01881.1   sequence type=CDS   gene model=Glyma11g01881   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGAAAATCTTGTTGAGGAGCTCCCTGGTGCCAATATCATCTTCTGTGACGTGTTAGAAGGTTCCATGGATATTTTAAAGTATCATGAACGTTATGGCTTTAGTATCACGAGCGAGGCCTGCTGTGGATTGGGGAAGTACAAGGGCTGGATCATGTGCTTATCACCGGAAATGGCATGCAGTAATGCCTCCTACCATATCTGGTGGGATCGGTTTCATCCAACTTATGCAGTGAATGCCATTCTGACAGACAATATATGGAATGGCTGGCACACTTAA

Predicted protein sequences of Glyma11g01881

Limit To All Plant Sequences

>Glyma11g01881.1   sequence type=predicted peptide   gene model=Glyma11g01881   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVENLVEELPGANIIFCDVLEGSMDILKYHERYGFSITSEACCGLGKYKGWIMCLSPEMACSNASYHIWWDRFHPTYAVNAILTDNIWNGWHT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain