SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g01762): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g01762): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g01762

Feature Type:gene_model
Chromosome:Gm11
Start:1054393
stop:1056433
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G08280AT Annotation by Michelle Graham. TAIR10: hydroxymethylbilane synthase | chr5:2663763-2665596 REVERSE LENGTH=382 SoyBaseE_val: 4.00E-129ISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006744GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquinone biosynthetic process SoyBaseN/AISS
GO:0006779GO-bp Annotation by Michelle Graham. GO Biological Process: porphyrin-containing compound biosynthetic process SoyBaseN/AISS
GO:0009073GO-bp Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family biosynthetic process SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009814GO-bp Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0018160GO-bp Annotation by Michelle Graham. GO Biological Process: peptidyl-pyrromethane cofactor linkage SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0033014GO-bp Annotation by Michelle Graham. GO Biological Process: tetrapyrrole biosynthetic process SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004418GO-mf Annotation by Michelle Graham. GO Molecular Function: hydroxymethylbilane synthase activity SoyBaseN/AISS
PTHR11557Panther PORPHOBILINOGEN DEAMINASE JGI ISS
PF01379PFAM Porphobilinogen deaminase, dipyromethane cofactor binding domain JGI ISS
PF03900PFAM Porphobilinogen deaminase, C-terminal domain JGI ISS
UniRef100_C6TEP8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=C6TEP8_SOYBN SoyBaseE_val: 3.00E-149ISS
UniRef100_G7JQM6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Porphobilinogen deaminase n=2 Tax=Medicago truncatula RepID=G7JQM6_MEDTR SoyBaseE_val: 3.00E-134ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g01762 not represented in the dataset

Glyma11g01762 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g015400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g01762.1   sequence type=CDS   gene model=Glyma11g01762   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCTGTTGCCGTTGAGCAACAGACTAAGGTCGCTCTCATCAGAATTGGTACCAGAGGAAGGAGACAAAATCCTCACACAACCACAGATGTTCCTACTTACTTGCCTGATAAAACAATTCTGCCATGTAACCTTCCGCGAGAGGATGTCAGAGATGCATTTATATCCCTGACTGCAGCTTCATTAGCTGATCTTCCCCCTGCAAGTGTTATTGGTACTGCTTCGTTAAGACGAAAGTCACAGATCCTCCACAGATATCCATCTCTAAATGTGCAGGAAAATTTCCGTGGCAATGTCCAAACAAGGTTAAGAAAACTCAATGAGGGGGTTGTCCAAGCTACACTATTAGCATTAGCTGGACTCAAACGCTTAAGTATGACAGAAAATGTGACTTCAATCCTATCAATTGATGATATGCTTCCAGCTGTTGCCCAAGGTGCTATTGGAATAGCATGTAGAAGTGATGACGATAAAATGGCGGAATACATTGCTACACTTAATCATGAAGAAACAAGACTAGCAGTTGTCTGTGAGAGGGCCTTTCTTCAGACTTTGGATGGGTCTTGCCGCACTCCTATTGCAGGGTATGCTTGCAGAAACGAGGATGGCAATTGTTTGTTTAGAGGATTAGTTGCTTCCCCTGATGGAACCCGGGTGCTAGAGACATCCAGGGTTGGTCCATATGCAGTTGAAGATATGATTGAAATGGGTGTTCAGTAG

>Glyma11g01762.1   sequence type=predicted peptide   gene model=Glyma11g01762   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SVAVEQQTKVALIRIGTRGRRQNPHTTTDVPTYLPDKTILPCNLPREDVRDAFISLTAASLADLPPASVIGTASLRRKSQILHRYPSLNVQENFRGNVQTRLRKLNEGVVQATLLALAGLKRLSMTENVTSILSIDDMLPAVAQGAIGIACRSDDDKMAEYIATLNHEETRLAVVCERAFLQTLDGSCRTPIAGYACRNEDGNCLFRGLVASPDGTRVLETSRVGPYAVEDMIEMGVQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo