SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g01536

Feature Type:gene_model
Chromosome:Gm11
Start:920812
stop:921168
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g01536
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G71420AT Annotation by Michelle Graham. TAIR10: Tetratricopeptide repeat (TPR)-like superfamily protein | chr1:26917822-26920059 REVERSE LENGTH=745 SoyBaseE_val: 1.00E-31ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR24015Panther FAMILY NOT NAMED JGI ISS
UniRef100_G7K7V0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pentatricopeptide repeat-containing protein n=1 Tax=Medicago truncatula RepID=G7K7V0_MEDTR SoyBaseE_val: 1.00E-51ISS
UniRef100_I1JAJ7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JAJ7_SOYBN SoyBaseE_val: 1.00E-57ISS

Expression Patterns of Glyma11g01536
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g01536 not represented in the dataset
Glyma11g01536 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g01536 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g013400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g01536
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g01536
>Glyma11g01536.1   sequence type=CDS   gene model=Glyma11g01536   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATTTGGCTCTGGTGGTCAATATCATCCAAACACGGGCAATGTTAAGCCGGCTTGAGATAGTGATTGGACAACTGAAAGAGATGGGTTATGTGCCAGAGCTTAGCTTAGCCTTGTATGACACGGAAGTGGAGCACAAAGAAGACCAATTGCTTCATCACAGTAAGAAGATGGCATTGGTATTTGCCATAATGAACGAAGGAATTAAAATAATGAAGAATATTCGTATTTGTGTGGATTGCCACAACTTCATGAAATTAGCATCATATCTATTTCAGAAGGAGATTGCTGCGAGAGATTCAAACTGTTTTCACCATTTCAAATATGCAGCATGCTCTTGTAATGACTATTGGTAA
Predicted protein sequences of Glyma11g01536
>Glyma11g01536.1   sequence type=predicted peptide   gene model=Glyma11g01536   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNLALVVNIIQTRAMLSRLEIVIGQLKEMGYVPELSLALYDTEVEHKEDQLLHHSKKMALVFAIMNEGIKIMKNIRICVDCHNFMKLASYLFQKEIAARDSNCFHHFKYAACSCNDYW*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo