Glyma11g01210 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g01210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g01210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g01210

Feature Type:	gene_model
Chromosome:	Gm11
Start:	706681
stop:	707472
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g01210

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G38050	AT	Annotation by Michelle Graham. TAIR10: 3-oxo-5-alpha-steroid 4-dehydrogenase family protein \| chr2:15921303-15922176 REVERSE LENGTH=262	SoyBase	E_val: 1.00E-116	ISS
GO:0009416	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to light stimulus	SoyBase	N/A	ISS
GO:0010268	GO-bp	Annotation by Michelle Graham. GO Biological Process: brassinosteroid homeostasis	SoyBase	N/A	ISS
GO:0016132	GO-bp	Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0009917	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sterol 5-alpha reductase activity	SoyBase	N/A	ISS
GO:0050213	GO-mf	Annotation by Michelle Graham. GO Molecular Function: progesterone 5-alpha-reductase activity	SoyBase	N/A	ISS
KOG1638	KOG	Steroid reductase	JGI		ISS
PTHR10556	Panther	3-OXO-5-ALPHA-STEROID 4-DEHYDROGENASE-RELATED	JGI		ISS
PTHR10556:SF2	Panther	3-OXO-5-ALPHA-STEROID 4-DEHYDROGENASE PUTATIVE	JGI		ISS
PF02544	PFAM	3-oxo-5-alpha-steroid 4-dehydrogenase	JGI		ISS
UniRef100_I1LFY8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LFY8_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q672H5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 5-alpha-reductase n=1 Tax=Pisum sativum RepID=Q672H5_PEA	SoyBase	E_val: 7.00E-137	ISS

Expression Patterns of Glyma11g01210

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g01210 not represented in the dataset	Glyma11g01210 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g01210 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g010000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g01210

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g01210

Limit To All Plant Sequences

>Glyma11g01210.1   sequence type=CDS   gene model=Glyma11g01210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCCCAGAACACTACTCCGACTCATCTCTCTTCCACCGCTCCCTCCTTACCCTCTTCCTAATCGCACCCCCCACCTTCCTCTCCCTCACCTTCCTCCAGGCCCCCTACGGCAAGCACCACAGGCCCGGCTGGGGGCCCAACCTCCCTCCCCCCTTAGCCTGGCTCTTCATGGAAAGCCCAACCCTCTGGCTCACCCTCCTCCTCTTCCCACTGGGCCTCCACTCCCACAACCCCAAAGCCCAAGCCCTCATCACCCCCTTCCTAATCCACTACTTCAACCGCACCATCCTCTACCCTCTCCACCTCCTCCTCACTCCTTCAAAGAAAACCCCAACGGGCTTCCCCCTCGGCGTAGCCCTAATGGCCTTCGCCTTCAACGTTCTCAATTCCTACCTCCAGGCCCGAACGGTCTCTCACTACATCAATCACTATGATGACTCGGGTTTTTTCTGGTTCCGGTTTTTGTGTGGGCTTTTGGTGTTTTTATTGGGGATGGGGATTAATGTATGGGCTGATAGGGTTTTGTTGCGGCTCAAGAGCGAGGGGAAGGGCTACGTGGTGCCGCGCGGTGGGTTGTTCGAGCTCGTGGCGTGTCCGAATTACTTTGGGGAGATTGTCGAGTGGCTGGGCTGGGCCGTGATGACTTGGTCATGGGCCGGGCTGGGCTTTTTTGTTTACACTTTTGCTAATTTGGGTCCAAGGGCCCGGGCCAACCGGAGGTGGTATTTGGAGAAGTTTGGGGAGGATTATCCCAAGGAGAGGAAGGCTGTTATTCCTTACTTGTATTGA

Predicted protein sequences of Glyma11g01210

Limit To All Plant Sequences

>Glyma11g01210.1   sequence type=predicted peptide   gene model=Glyma11g01210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIPEHYSDSSLFHRSLLTLFLIAPPTFLSLTFLQAPYGKHHRPGWGPNLPPPLAWLFMESPTLWLTLLLFPLGLHSHNPKAQALITPFLIHYFNRTILYPLHLLLTPSKKTPTGFPLGVALMAFAFNVLNSYLQARTVSHYINHYDDSGFFWFRFLCGLLVFLLGMGINVWADRVLLRLKSEGKGYVVPRGGLFELVACPNYFGEIVEWLGWAVMTWSWAGLGFFVYTFANLGPRARANRRWYLEKFGEDYPKERKAVIPYLY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain