SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma11g00530

Feature Type:gene_model
Chromosome:Gm11
Start:188971
stop:189543
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G20600AT Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family | chr3:7194877-7195536 FORWARD LENGTH=219 SoyBaseE_val: 9.00E-14ISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0009626GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type hypersensitive response SoyBaseN/AISS
GO:0009814GO-bp Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction SoyBaseN/AISS
GO:0009816GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium, incompatible interaction SoyBaseN/AISS
GO:0009817GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction SoyBaseN/AISS
GO:0010942GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of cell death SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0046658GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane SoyBaseN/AISS
GO:0004871GO-mf Annotation by Michelle Graham. GO Molecular Function: signal transducer activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF03168PFAM Late embryogenesis abundant protein JGI ISS
UniRef100_D2CFI3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Non-race specific disease resistance protein 1-like protein b n=1 Tax=Coffea arabica RepID=D2CFI3_COFAR SoyBaseE_val: 6.00E-13ISS
UniRef100_I1LFR0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LFR0_SOYBN SoyBaseE_val: 2.00E-123ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma01g45140 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g003000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g00530.1   sequence type=CDS   gene model=Glyma11g00530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGTGAAGGCAAGAGTCTCTACATATGGCCCCTGAAAGTTATAGGCCTCTTAGGCCTTATTGTTCTGTGCCTGTGGCTGGCCTTACGTCCCAAGAACCCCTCCTACTCCATTATGTTCATCTCCATACAACATCCCTCCAACTCAAGTGAAAACTGCACCATCTTTTACAGCCTTCAAATTGAAAACCCAAACAAGGACTCGAGCATTTACTATGACAAAACGATTTTAAGTTTCTTATATGGGGAGCCTGAGGACGAGGTGGGGGAGACAACTATAGTCCCATTCCATCAAGGAACTGGCAACACCCGGGATGTATCTGATACTGTTAATGCCAAACCTCGACCATTCAAACCTCTCTTCAGTGCCATCTCAAATGCAACCACAGAGTTAAAAGTTGCTTTGATCACAAGATACCGATACAAGACATGGGGAATTAAGAGCAAGTTCCACGGGTTACAACTCAAAGGTATTCTACCAATTGATTCCGATGGGAAGCTCTCACGTAAGAAGAAAAAGTACCCACTTAGCCGTAATTCCAACAAACTAGGAAGGTTCAAAATAAGGCACTGA

>Glyma11g00530.1   sequence type=predicted peptide   gene model=Glyma11g00530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCEGKSLYIWPLKVIGLLGLIVLCLWLALRPKNPSYSIMFISIQHPSNSSENCTIFYSLQIENPNKDSSIYYDKTILSFLYGEPEDEVGETTIVPFHQGTGNTRDVSDTVNAKPRPFKPLFSAISNATTELKVALITRYRYKTWGIKSKFHGLQLKGILPIDSDGKLSRKKKKYPLSRNSNKLGRFKIRH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo