SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g00330

Feature Type:gene_model
Chromosome:Gm11
Start:67235
stop:68908
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g00330
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G43740AT Annotation by Michelle Graham. TAIR10: Leucine-rich repeat (LRR) family protein | chr3:15644127-15645446 FORWARD LENGTH=218 SoyBaseE_val: 7.00E-57ISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PF00560PFAM Leucine Rich Repeat JGI ISS
PF08263PFAM Leucine rich repeat N-terminal domain JGI ISS
UniRef100_C6ZS01UniRef Annotation by Michelle Graham. Most informative UniRef hit: Leucine-rich repeat family protein n=1 Tax=Glycine max RepID=C6ZS01_SOYBN SoyBaseE_val: 4.00E-66ISS
UniRef100_I1LFP3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LFP3_SOYBN SoyBaseE_val: 8.00E-160ISS

Expression Patterns of Glyma11g00330
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g00330
ParalogEvidenceComments
Glyma01g45420 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g00330 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g001300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g00330
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g00330
>Glyma11g00330.1   sequence type=CDS   gene model=Glyma11g00330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTAGTTTGGTTTTTGTATTTGCGTTATTTGTATTTCTCCAACGTCCTCTCTCGTGCTTGTCAAACTCCCAAGTTGACGCTCTGTCTGCTTTGAGAAGCCGTCTTTCTGACCCGAAGAACGTACTGGAGAGCTGGGACACTTCTCTCGTTGATCCTTGTACTTGGTTCCATGTTACCTGCGACTCCAACAACAACGTCATTCGCTTAGATTTGGGCCACAATGATTTATCTGGAACTTTGGCCCCAGAACTTGCCCAGCTATCCTCCCTCCAGTACCTGTATGTATTCTCTTCCTCACTTATTGCTGAGCTCTATGGGAATCAAATAAGTGGGACCATTCCTGAGCAACTTGGTAACTTGAAGAGCCTTATTAGTATGGATTTGTATGATAACCTATTGGAAGGGAATATCCCAAACTCATTTGGCAACTTAAAGTCACTCAAATTCCTACGCCTAAACAACAACAAGCTAACAGGATCTATCCCAAAAGAGGTCATTGATCTTAATCTCCAAGTCCTTTACAACACAGATTTGGTTATGCCATGTTCAGCCATCCCCGAGTTCAACCTCTGCGAATTGAAATTAATAAGCTCTAGTGATCAGCATTCAGCAATGTCCAAGACAGCCAAACACGTCATCCCGCTAGCTTGGTTTAGAATCACTTTGCATTAA
Predicted protein sequences of Glyma11g00330
>Glyma11g00330.1   sequence type=predicted peptide   gene model=Glyma11g00330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSLVFVFALFVFLQRPLSCLSNSQVDALSALRSRLSDPKNVLESWDTSLVDPCTWFHVTCDSNNNVIRLDLGHNDLSGTLAPELAQLSSLQYLYVFSSSLIAELYGNQISGTIPEQLGNLKSLISMDLYDNLLEGNIPNSFGNLKSLKFLRLNNNKLTGSIPKEVIDLNLQVLYNTDLVMPCSAIPEFNLCELKLISSSDQHSAMSKTAKHVIPLAWFRITLH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo