SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g44560): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g44560): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g44560

Feature Type:gene_model
Chromosome:Gm10
Start:50887072
stop:50889496
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13120AT Annotation by Michelle Graham. TAIR10: cyclophilin 20-2 | chr5:4162714-4164720 REVERSE LENGTH=255 SoyBaseE_val: 8.00E-112ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0010275GO-bp Annotation by Michelle Graham. GO Biological Process: NAD(P)H dehydrogenase complex assembly SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009533GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stromal thylakoid SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0003755GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidyl-prolyl cis-trans isomerase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0043424GO-mf Annotation by Michelle Graham. GO Molecular Function: protein histidine kinase binding SoyBaseN/AISS
KOG0880 KOG Peptidyl-prolyl cis-trans isomerase JGI ISS
PTHR11071Panther CYCLOPHILIN JGI ISS
PTHR11071:SF60Panther PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (CYCLOPHILIN) JGI ISS
PF00160PFAM Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD JGI ISS
UniRef100_I1LFL7UniRef Annotation by Michelle Graham. Best UniRef hit: Peptidyl-prolyl cis-trans isomerase n=2 Tax=Glycine max RepID=I1LFL7_SOYBN SoyBaseE_val: 0ISS
UniRef100_I1LFL7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peptidyl-prolyl cis-trans isomerase n=2 Tax=Glycine max RepID=I1LFL7_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g44560 not represented in the dataset

Glyma10g44560 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma20g39340 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g298200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g44560.1   sequence type=CDS   gene model=Glyma10g44560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCATGGCGGCTGCATTTGCAACTACAACTGCAACACTGAGACTGCCAAATGTTGGAGAAAGCAAAAGTTTGCAGCTCCGTAAGTGTAACCCTAATCCCAATAAGCTTAAGGTTATGCGGGGGTTTGGCGGTTGTTCTGGAGTGGCAGTGAGTGTGAGAATTGGAATTGGAAGGGTTCGGGCGAGTTCGAGTTCTTCTTCTTCTGAGGAGGAGGAGGAGGCAGTGAGTGTGCAGTCAAAAGTGACTCAGAAAGTATACTTCGACGTGAGTATTGGAAATCCAGTTGGGAAGTTTGTGGGACGGATTGTGATTGGACTGTACGGCGACGATGTCCCCCAAACGGCTGAGAACTTCCGTGCCCTTTGTACTGGCGAGAAGGGCTTTGGATATAAGGGTTCTACCGTCCATCGTGTCATCAAGGATTTCATGATTCAAGGAGGAGACTTTGACAAAGGAAATGGAACTGGAGGCAAAAGTATATATGGTCGTACTTTCAAAGATGAGAATTTTAATTTGTCTCACACTGGACCGGGAGTTGTCAGCATGGCAAATGCAGGTCCCAACACAAATGGGAGTCAGTTTTTTATATGCACTGTCAAGACACCTTGGCTGGATCAGAGGCATGTGGTATTTGGCCAAGTTTTGGAAGGCATGGCCATTGTTAGGTTGATCGAATCACAGGAGACAGATAGGGGTGACCGTCCTAGAAAGAAGGTGACCATTAGTGACTGTGGTGAGCTTCCAATTGCTTGA

>Glyma10g44560.1   sequence type=predicted peptide   gene model=Glyma10g44560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMAAAFATTTATLRLPNVGESKSLQLRKCNPNPNKLKVMRGFGGCSGVAVSVRIGIGRVRASSSSSSSEEEEEAVSVQSKVTQKVYFDVSIGNPVGKFVGRIVIGLYGDDVPQTAENFRALCTGEKGFGYKGSTVHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFNLSHTGPGVVSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMAIVRLIESQETDRGDRPRKKVTISDCGELPIA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo