Report for Sequence Feature Glyma10g44560
Feature Type: gene_model
Chromosome: Gm10
Start: 50887072
stop: 50889496
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g44560
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G13120 AT
Annotation by Michelle Graham. TAIR10: cyclophilin 20-2 | chr5:4162714-4164720 REVERSE LENGTH=255
SoyBase E_val: 8.00E-112 ISS
GO:0006457 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein folding
SoyBase N/A ISS
GO:0010275 GO-bp
Annotation by Michelle Graham. GO Biological Process: NAD(P)H dehydrogenase complex assembly
SoyBase N/A ISS
GO:0019344 GO-bp
Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0009533 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stromal thylakoid
SoyBase N/A ISS
GO:0009534 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid
SoyBase N/A ISS
GO:0009535 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane
SoyBase N/A ISS
GO:0009543 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen
SoyBase N/A ISS
GO:0009579 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: thylakoid
SoyBase N/A ISS
GO:0031977 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen
SoyBase N/A ISS
GO:0003755 GO-mf
Annotation by Michelle Graham. GO Molecular Function: peptidyl-prolyl cis-trans isomerase activity
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
GO:0043424 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein histidine kinase binding
SoyBase N/A ISS
KOG0880
KOG
Peptidyl-prolyl cis-trans isomerase
JGI ISS
PTHR11071 Panther
CYCLOPHILIN
JGI ISS
PTHR11071:SF60 Panther
PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (CYCLOPHILIN)
JGI ISS
PF00160 PFAM
Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
JGI ISS
UniRef100_I1LFL7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Peptidyl-prolyl cis-trans isomerase n=2 Tax=Glycine max RepID=I1LFL7_SOYBN
SoyBase E_val: 0 ISS
UniRef100_I1LFL7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Peptidyl-prolyl cis-trans isomerase n=2 Tax=Glycine max RepID=I1LFL7_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma10g44560
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma10g44560
Paralog Evidence Comments
Glyma20g39340 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma10g44560 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g298200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g44560
Coding sequences of Glyma10g44560
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g44560.1 sequence type=CDS gene model=Glyma10g44560 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCCATGGCGGCTGCATTTGCAACTACAACTGCAACACTGAGACTGCCAAATGTTGGAGAAAGCAAAAGTTTGCAGCTCCGTAAGTGTAACCCTAATCCCAATAAGCTTAAGGTTATGCGGGGGTTTGGCGGTTGTTCTGGAGTGGCAGTGAGTGTGAGAATTGGAATTGGAAGGGTTCGGGCGAGTTCGAGTTCTTCTTCTTCTGAGGAGGAGGAGGAGGCAGTGAGTGTGCAGTCAAAAGTGACTCAGAAAGTATACTTCGACGTGAGTATTGGAAATCCAGTTGGGAAGTTTGTGGGACGGATTGTGATTGGACTGTACGGCGACGATGTCCCCCAAACGGCTGAGAACTTCCGTGCCCTTTGTACTGGCGAGAAGGGCTTTGGATATAAGGGTTCTACCGTCCATCGTGTCATCAAGGATTTCATGATTCAAGGAGGAGACTTTGACAAAGGAAATGGAACTGGAGGCAAAAGTATATATGGTCGTACTTTCAAAGATGAGAATTTTAATTTGTCTCACACTGGACCGGGAGTTGTCAGCATGGCAAATGCAGGTCCCAACACAAATGGGAGTCAGTTTTTTATATGCACTGTCAAGACACCTTGGCTGGATCAGAGGCATGTGGTATTTGGCCAAGTTTTGGAAGGCATGGCCATTGTTAGGTTGATCGAATCACAGGAGACAGATAGGGGTGACCGTCCTAGAAAGAAGGTGACCATTAGTGACTGTGGTGAGCTTCCAATTGCTTGA
Predicted protein sequences of Glyma10g44560
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g44560.1 sequence type=predicted peptide gene model=Glyma10g44560 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAMAAAFATTTATLRLPNVGESKSLQLRKCNPNPNKLKVMRGFGGCSGVAVSVRIGIGRVRASSSSSSSEEEEEAVSVQSKVTQKVYFDVSIGNPVGKFVGRIVIGLYGDDVPQTAENFRALCTGEKGFGYKGSTVHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFNLSHTGPGVVSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMAIVRLIESQETDRGDRPRKKVTISDCGELPIA*