Glyma10g44521 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g44521): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g44521): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g44521

Feature Type:	gene_model
Chromosome:	Gm10
Start:	50853461
stop:	50855279
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g44521

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G16970	AT	Annotation by Michelle Graham. TAIR10: KU70 homolog \| chr1:5801159-5805724 REVERSE LENGTH=621	SoyBase	E_val: 5.00E-23	ISS
GO:0000723	GO-bp	Annotation by Michelle Graham. GO Biological Process: telomere maintenance	SoyBase	N/A	ISS
GO:0006281	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA repair	SoyBase	N/A	ISS
GO:0006303	GO-bp	Annotation by Michelle Graham. GO Biological Process: double-strand break repair via nonhomologous end joining	SoyBase	N/A	ISS
GO:0009408	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to heat	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005958	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: DNA-dependent protein kinase-DNA ligase 4 complex	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003690	GO-mf	Annotation by Michelle Graham. GO Molecular Function: double-stranded DNA binding	SoyBase	N/A	ISS
GO:0004003	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP-dependent DNA helicase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PTHR12604	Panther	KU AUTOANTIGEN DNA HELICASE	JGI		ISS
PTHR12604:SF2	Panther	KU AUTOANTIGEN K86 DNA HELICASE-RELATED	JGI		ISS
PF03730	PFAM	Ku70/Ku80 C-terminal arm	JGI		ISS
UniRef100_A7MAS2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ku70-like protein n=1 Tax=Vigna radiata RepID=A7MAS2_VIGRA	SoyBase	E_val: 2.00E-42	ISS
UniRef100_I1LFL3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LFL3_SOYBN	SoyBase	E_val: 1.00E-53	ISS

Expression Patterns of Glyma10g44521

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g44521 not represented in the dataset	Glyma10g44521 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g44521

Paralog	Evidence	Comments
Glyma20g39280	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g44521 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma10g44521

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g44521

Limit To All Plant Sequences

>Glyma10g44521.1   sequence type=CDS   gene model=Glyma10g44521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTCTTGTTGTTAACAAAAAGTTTTACTTTTCAGCCTTGCAGAGACACTATGCAGTATTGCAGGCATTGGCACTGGAAGAGGATGATATTCCAGAAATGAAAGATGAAACATTACCTGACGAGGAAGGTTTAGCCAGACCAGCAGTGGTAAGGGCATTAGAAGAATTCAAAACCTCTGTATATGGGGATAATTATGAAGAGGAAAATAAGCCTGGCACTGGGAAGCCTACTGAAGCCTCCAAGAAACAAAAAGCAATTGCTGAGTTTGCAACAAAAGAGTGTGAAAACTATGACTGA

Predicted protein sequences of Glyma10g44521

Limit To All Plant Sequences

>Glyma10g44521.1   sequence type=predicted peptide   gene model=Glyma10g44521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MILVVNKKFYFSALQRHYAVLQALALEEDDIPEMKDETLPDEEGLARPAVVRALEEFKTSVYGDNYEEENKPGTGKPTEASKKQKAIAEFATKECENYD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain