Glyma10g43690 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g43690): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g43690): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g43690

Feature Type:	gene_model
Chromosome:	Gm10
Start:	50274039
stop:	50276114
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g43690

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G39470	AT	Annotation by Michelle Graham. TAIR10: PsbP-like protein 2 \| chr2:16476335-16477653 FORWARD LENGTH=238	SoyBase	E_val: 3.00E-92	ISS
GO:0010207	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II assembly	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0016556	GO-bp	Annotation by Michelle Graham. GO Biological Process: mRNA modification	SoyBase	N/A	ISS
GO:0019344	GO-bp	Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009523	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: photosystem II	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009543	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0009654	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: oxygen evolving complex	SoyBase	N/A	ISS
GO:0019898	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extrinsic to membrane	SoyBase	N/A	ISS
GO:0030095	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast photosystem II	SoyBase	N/A	ISS
GO:0005509	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calcium ion binding	SoyBase	N/A	ISS
PF01789	PFAM	PsbP	JGI		ISS
UniRef100_D7LD51	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Photosystem II reaction center PsbP family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LD51_ARALL	SoyBase	E_val: 5.00E-90	ISS
UniRef100_I1LFD2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LFD2_SOYBN	SoyBase	E_val: 6.00E-175	ISS

Expression Patterns of Glyma10g43690

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g43690 not represented in the dataset	Glyma10g43690 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g43690

Paralog	Evidence	Comments
Glyma20g23100	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g43690 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g290700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g43690

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g43690

Limit To All Plant Sequences

>Glyma10g43690.1   sequence type=CDS   gene model=Glyma10g43690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGTTTCTTCGTGCTCTTTGAGCTGGATTTCACCCTGCTTATCCCATAAGCTAAACTTACCACATACAAATTGTTTGCCACGCAACACTGCAACTTCCTCTTCCAACACTGTCTTTTGTGCATTGGAGACAAACCCCAGAGGAGAAATCTTCTGCCAGAGAAGACCGCTACTGTTGGGCGTTGGAGCATTAACTGCAAATTTACAACCAATAAATTTGGTCTTTGCTCAAGAAAAACCAGACAGATACCGAGCTTTTGTGGACTATGAAGATGGATATTCTTACGTATATCCCATTGATTGGAAGGAATTTGACTTCAGGGCTCATGATTCTGCATTCAAAGACAGATATCTACAGTTACAGAATGTAAGGGTGAGATTTATACCAACTGAGAAGAAAGACATCCGAGAATTGGGTCCCATGGAAGAGGTTGTATACGATTTGGTGAAACATAGATACGCTGCACCAAACCAAAGACCAACAATAAATGACATGCAGGAGAAAACCATAGATGGAAAACATTACTATACCTTTGAATATATACTTACATCACCAAATTACTCTAGTGCCTCCTTTGCAACAATTGCTATAGGAAATGGAAGGTACTACACATTAATTGTTGGAGCCAATGAAAGGCGATGGAAAAGATTTCGAGATCAGCTTAAAGTGGTAGCAGACTCCTTTAGGCTTCTTGACATCTGA

Predicted protein sequences of Glyma10g43690

Limit To All Plant Sequences

>Glyma10g43690.1   sequence type=predicted peptide   gene model=Glyma10g43690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVSSCSLSWISPCLSHKLNLPHTNCLPRNTATSSSNTVFCALETNPRGEIFCQRRPLLLGVGALTANLQPINLVFAQEKPDRYRAFVDYEDGYSYVYPIDWKEFDFRAHDSAFKDRYLQLQNVRVRFIPTEKKDIRELGPMEEVVYDLVKHRYAAPNQRPTINDMQEKTIDGKHYYTFEYILTSPNYSSASFATIAIGNGRYYTLIVGANERRWKRFRDQLKVVADSFRLLDI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain