SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g43500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g43500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g43500

Feature Type:gene_model
Chromosome:Gm10
Start:50164214
stop:50166760
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g43500
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G08535AT Annotation by Michelle Graham. TAIR10: D111/G-patch domain-containing protein | chr5:2762722-2763320 FORWARD LENGTH=116 SoyBaseE_val: 2.00E-35ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
PTHR23106Panther FAMILY NOT NAMED JGI ISS
PTHR23106:SF1Panther SUBFAMILY NOT NAMED JGI ISS
PF01585PFAM G-patch domain JGI ISS
UniRef100_B9RGI9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nucleic acid binding protein, putative n=1 Tax=Ricinus communis RepID=B9RGI9_RICCO SoyBaseE_val: 9.00E-46ISS
UniRef100_I1LFB7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LFB7_SOYBN SoyBaseE_val: 2.00E-83ISS

Expression Patterns of Glyma10g43500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g43500 not represented in the dataset
Glyma10g43500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g43500 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g288900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g43500
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g43500
>Glyma10g43500.1   sequence type=CDS   gene model=Glyma10g43500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGAGATGTCGGGTTTAGCAACAGCAATAAACTCTTCCAACATAGGATTTCAGCTATTGAAGAAGCATGGGTGGAAAGAAGGGACTGGTCTTGGAGTCTCTGAGCAGGGTAGGTTAGAACCTGTGGAGACTCATGTAAAGAATAATAAACGAGGTTTGGGAGCAGATAAAGCGAAGAAAAAGGTTGTCAAAGCAAAACCTGATCAAAGCGATTCCTCTAAAGGGAACAATCAGCAGGATCATTTACCTCAAAAGAAAAGCAAAACACTTTCTAAACGGATGAGAAAGATGCAGGAATTTGAAAAGAAGATGCGAGAGAAGGAATTTGAGCGTGCTTTCTTCAGAGAGTTCTGGCCTGAAAATGTGTAA
Predicted protein sequences of Glyma10g43500
>Glyma10g43500.1   sequence type=predicted peptide   gene model=Glyma10g43500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEEMSGLATAINSSNIGFQLLKKHGWKEGTGLGVSEQGRLEPVETHVKNNKRGLGADKAKKKVVKAKPDQSDSSKGNNQQDHLPQKKSKTLSKRMRKMQEFEKKMREKEFERAFFREFWPENV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo