SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g42100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g42100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g42100

Feature Type:gene_model
Chromosome:Gm10
Start:49126395
stop:49128479
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G68530AT Annotation by Michelle Graham. TAIR10: 3-ketoacyl-CoA synthase 6 | chr1:25712881-25714733 REVERSE LENGTH=497 SoyBaseE_val: 0ISS
GO:0000038GO-bp Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid metabolic process SoyBaseN/AISS
GO:0000096GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process SoyBaseN/AISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0006546GO-bp Annotation by Michelle Graham. GO Biological Process: glycine catabolic process SoyBaseN/AISS
GO:0006633GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process SoyBaseN/AISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0006733GO-bp Annotation by Michelle Graham. GO Biological Process: oxidoreduction coenzyme metabolic process SoyBaseN/AISS
GO:0006766GO-bp Annotation by Michelle Graham. GO Biological Process: vitamin metabolic process SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0008610GO-bp Annotation by Michelle Graham. GO Biological Process: lipid biosynthetic process SoyBaseN/AISS
GO:0008652GO-bp Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process SoyBaseN/AISS
GO:0009072GO-bp Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family metabolic process SoyBaseN/AISS
GO:0009106GO-bp Annotation by Michelle Graham. GO Biological Process: lipoate metabolic process SoyBaseN/AISS
GO:0009108GO-bp Annotation by Michelle Graham. GO Biological Process: coenzyme biosynthetic process SoyBaseN/AISS
GO:0009117GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009826GO-bp Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010025GO-bp Annotation by Michelle Graham. GO Biological Process: wax biosynthetic process SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010155GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of proton transport SoyBaseN/AISS
GO:0010218GO-bp Annotation by Michelle Graham. GO Biological Process: response to far red light SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0015994GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll metabolic process SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0016226GO-bp Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly SoyBaseN/AISS
GO:0019216GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of lipid metabolic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019748GO-bp Annotation by Michelle Graham. GO Biological Process: secondary metabolic process SoyBaseN/AISS
GO:0031408GO-bp Annotation by Michelle Graham. GO Biological Process: oxylipin biosynthetic process SoyBaseN/AISS
GO:0042335GO-bp Annotation by Michelle Graham. GO Biological Process: cuticle development SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0044272GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur compound biosynthetic process SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0016747GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups SoyBaseN/AISS
PF08392PFAM FAE1/Type III polyketide synthase-like protein JGI ISS
PF08541PFAM 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal JGI ISS
UniRef100_I1NFI7UniRef Annotation by Michelle Graham. Most informative UniRef hit: 3-ketoacyl-CoA synthase n=1 Tax=Glycine max RepID=I1NFI7_SOYBN SoyBaseE_val: 0ISS
UniRef100_UPI000189D543UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000189D543 related cluster n=1 Tax=unknown RepID=UPI000189D543 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g42100 not represented in the dataset

Glyma10g42100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma20g24930 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g274400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g42100.1   sequence type=CDS   gene model=Glyma10g42100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTCCAATCTTGCCGGATTTCTCCAACTCGGTGAAACTCAAGTACGTGAAACTAGGGTACCAATACCTGGTGAACCACATTCTGACTCTCACTCTCATACCCATGATGATCGCCATCTTCATGGAGATTCTACGCTTAGGCCCTGAAGAGATCCTGAACCTCTGGCACTCCCTCCACTTGGACCTTGTCCAAATCCTCTGCTCCGCCTTCCTCATCATCTTCATCGCCACCGTCTACTTCATGTCCAAACCCCGCACCATCTACCTCGTCGACTACGCCTGCTTCAAGCCACCCGTCACCTGCCGCGTCCCCTTCGCAACCTTCATGGAACACTCCAGGCTCATCCTTAAAGACAACCCTAAGAGCGTCGAGTTCCAAATGCGTATTCTCGAACGTTCCGGTCTCGGTGAAGAAACATGTCTCCCCCCAGCAATCCACTACATCCCTCCCAAGCCCACCATGGAGGCCGCCCGAGGAGAAGCCGAACTTGTTATCTTCTCCGCCATGGATTCTTTGTTCAACAAAACAGGTCTCAAGCCTAAGGACATAGATATTCTTATTGTCAATTGCAGTCTTTTTTCTCCCACTCCTTCTTTGTCTGCTATGGTCATCAACAAGTACAAGCTCAGGAGCAACATCAAGAGCTTCAACCTCTCCGGCATGGGTTGCAGTGCTGGCTTGATATCCGTTGACTTGGCTCGTGACCTTCTCCAGGTTCACCCTAACTCAAACGCCGTCGTTGTAAGCACCGAGATCATCACCCCTAACTACTACCAAGGCAAAGAGAGAGCCATGCTTCTTCCTAATTGCCTCTTCCGAATGGGGGGTGCTGCTATTCTCTTATCCAACCGAACCTCCGAACGCAGGAGAGCCAAGTACAGGTTGGTGCACGTTGTTCGCACTCACAAAGGCGCTGATGACAAAGCCTACCGTTGCGTTTTTGAAGAGGAAGACAGAGAAGGGAAAGTGGGGATTTCACTTCAGAAGGATCTCATGGCTATTGCAGGTGAGGCTCTCAAGTCTAACATTACTACTATGGGTCCTCTTGTTCTTCCGGCTTCCGAGCAGTTGCTGTTCCTTCTCACTCTCATTGGGAGGAAAATCTTCAACCCCAAATGGAAGCCTTATATTCCTGACTTCAAACAAGCCTTTGAGCACTTCTGCATCCACGCTGGTGGACGTGCTGTGATTGATGAGCTTCAGAAGAATCTTCAGCTTTCTACTGAACACGTTGAGGCTTCTAGAATGACCCTTCACAGGTTTGGGAACACTTCGTCTTCTTCGCTGTGGTATGAGCTCAACTACATTGAGTCCAAGGGGAGGATGAAGAAGGGTGATAGGGTGTGGCAGATAGCGTTTGGGAGTGGCTTTAAATGCAACAGTGCTGTGTGGAAGTGCAACAGAAGCATTAAGACACCGGTTGATGGGCCTTGGGCTGATTGCATTGATCGTTACCCGGTCGATATTCCTGAGATCGTTAAGCTCTAG

>Glyma10g42100.1   sequence type=predicted peptide   gene model=Glyma10g42100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPPILPDFSNSVKLKYVKLGYQYLVNHILTLTLIPMMIAIFMEILRLGPEEILNLWHSLHLDLVQILCSAFLIIFIATVYFMSKPRTIYLVDYACFKPPVTCRVPFATFMEHSRLILKDNPKSVEFQMRILERSGLGEETCLPPAIHYIPPKPTMEAARGEAELVIFSAMDSLFNKTGLKPKDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVVVSTEIITPNYYQGKERAMLLPNCLFRMGGAAILLSNRTSERRRAKYRLVHVVRTHKGADDKAYRCVFEEEDREGKVGISLQKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRSIKTPVDGPWADCIDRYPVDIPEIVKL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo