SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g42010): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g42010): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g42010

Feature Type:gene_model
Chromosome:Gm10
Start:49025456
stop:49028804
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G25420AT Annotation by Michelle Graham. TAIR10: Regulator of Vps4 activity in the MVB pathway protein | chr1:8916141-8917980 FORWARD LENGTH=323 SoyBaseE_val: 4.00E-124ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0048573GO-bp Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
KOG2027 KOG Spindle pole body protein JGI ISS
PTHR12161Panther UNCHARACTERIZED DUF292 JGI ISS
PTHR12161:SF4Panther gb def: agcp6260 [anopheles gambiae str. pest] JGI ISS
PF03398PFAM Regulator of Vps4 activity in the MVB pathway JGI ISS
UniRef100_G7IDA8UniRef Annotation by Michelle Graham. Most informative UniRef hit: IST1-like protein (Fragment) n=1 Tax=Medicago truncatula RepID=G7IDA8_MEDTR SoyBaseE_val: 7.00E-146ISS
UniRef100_I1LEW2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LEW2_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g42010 not represented in the dataset

Glyma10g42010 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma20g25010 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g273700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g42010.1   sequence type=CDS   gene model=Glyma10g42010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCACTTATTAACCAGCTCTTTAACAGAGGCGTTTTCGGCACTCGATGCAAAACATGCCTGAACCTGGCAATTTCACGAATTAAGCTGCTGCAAAACAAGAGAGATATCCAACTGAAACAAATGTGCAAGGAGATTAGCCAATTCTTGCAGGCTGGCCAAGAGGCAATTGCTAGAATTAGGGTGGAGCATATCATACGAGAACAAAATACATGGGCTGCATATGAAATATTGGAGTTGTTCTGTGAATTTGTTCTAGCACGTGTACCTATAATTGAGAACCAGAGGGAGTGCCCCACAGAATTGCGAGAAGCCATTGCAAGTATAATTTTTGCTGCTCCTAGATGTTCAGATGTACCAGACTTATTGCACATCAAGAACTTGTTTACCACTAAATATGGGAAAGAATTTGTCTCTGCAGTATCTGAACTTCGTCCTGATTCGGGCGTGAACCGCACGATCATCGAAAAGCTTTCAGTTAGTGCTCCATCTGGAGAGGTAAAACTCAAGGTCTTGAGGGAGATTGCAGAAGAATACAATATAGCATGGGATTCTTCTAAAACTGAGGCTGAATTTAGGAAAAACCATGAAGATCTCCTGGGTGGAGCAAAACAAGTTAGTGCTGGAGCTACGCTTTCTCATACTCCCAACAGAAATGGTTCTAATAATCCATCACCTCGTATTACGGAACCTTCTATCAAGTCTGTGCATGCTAAGCAAGAATATAAACCCCTTGAAGCTCCCAGCCCTTCTAACAATAATTCTTTGTTGAATACTAATGAAATCGAACATTCGCACGAAAATAATGATGTTCCTGCTGGAGATGCTAAAAGTGAGATAAGATTTCAATCCTCTGATGTACTGGAGAAGGCGCGGGCTGCCATTGCTTCTGCAGATCGTGCATCTGCAGCTGCTCGTGCTGCTGCTGCACTAGTTCAGAGTAATTTTGGATCATTGAAACTGGGAGGTAAATAA

>Glyma10g42010.1   sequence type=predicted peptide   gene model=Glyma10g42010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLINQLFNRGVFGTRCKTCLNLAISRIKLLQNKRDIQLKQMCKEISQFLQAGQEAIARIRVEHIIREQNTWAAYEILELFCEFVLARVPIIENQRECPTELREAIASIIFAAPRCSDVPDLLHIKNLFTTKYGKEFVSAVSELRPDSGVNRTIIEKLSVSAPSGEVKLKVLREIAEEYNIAWDSSKTEAEFRKNHEDLLGGAKQVSAGATLSHTPNRNGSNNPSPRITEPSIKSVHAKQEYKPLEAPSPSNNNSLLNTNEIEHSHENNDVPAGDAKSEIRFQSSDVLEKARAAIASADRASAAARAAAALVQSNFGSLKLGGK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo