SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g40990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g40990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g40990

Feature Type:gene_model
Chromosome:Gm10
Start:48189115
stop:48191498
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G34160AT Annotation by Michelle Graham. TAIR10: CYCLIN D3;1 | chr4:16357903-16359304 FORWARD LENGTH=376 SoyBaseE_val: 9.00E-112ISS
GO:0000080GO-bp Annotation by Michelle Graham. GO Biological Process: G1 phase of mitotic cell cycle SoyBaseN/AISS
GO:0000082GO-bp Annotation by Michelle Graham. GO Biological Process: G1/S transition of mitotic cell cycle SoyBaseN/AISS
GO:0000087GO-bp Annotation by Michelle Graham. GO Biological Process: M phase of mitotic cell cycle SoyBaseN/AISS
GO:0000280GO-bp Annotation by Michelle Graham. GO Biological Process: nuclear division SoyBaseN/AISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0006275GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication SoyBaseN/AISS
GO:0009735GO-bp Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus SoyBaseN/AISS
GO:0009741GO-bp Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0010103GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis SoyBaseN/AISS
GO:0010389GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of G2/M transition of mitotic cell cycle SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0042127GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell proliferation SoyBaseN/AISS
GO:0048316GO-bp Annotation by Michelle Graham. GO Biological Process: seed development SoyBaseN/AISS
GO:0051225GO-bp Annotation by Michelle Graham. GO Biological Process: spindle assembly SoyBaseN/AISS
GO:0051322GO-bp Annotation by Michelle Graham. GO Biological Process: anaphase SoyBaseN/AISS
GO:0051329GO-bp Annotation by Michelle Graham. GO Biological Process: interphase of mitotic cell cycle SoyBaseN/AISS
GO:0051726GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0016538GO-mf Annotation by Michelle Graham. GO Molecular Function: cyclin-dependent protein kinase regulator activity SoyBaseN/AISS
KOG0656 KOG G1/S-specific cyclin D JGI ISS
PTHR10177Panther CYCLINS JGI ISS
PTHR10177:SF76Panther CYCLIN-D JGI ISS
PF00134PFAM Cyclin, N-terminal domain JGI ISS
PF02984PFAM Cyclin, C-terminal domain JGI ISS
UniRef100_I1LEK8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LEK8_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q6T2Z6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cyclin d3 n=1 Tax=Glycine max RepID=Q6T2Z6_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g40990 not represented in the dataset

Glyma10g40990 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma20g26290 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g263500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g40990.1   sequence type=CDS   gene model=Glyma10g40990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAATTCAGCACCACAATGACCAACTAGAGCATAATGAAAATGTCTCATCTGTCCTTGATGCCCTTTACTGTGACGAAGGAAAGTGGGAAGAGGAAGAGGAGGAGAAAGAAGAAGAAGAAGATGAAGGTGAAAATGAAAGTGAAGTGACAACAAACACTGCAACTTGTCTTTTCCCTCTGCTCTTGTTGGAGCAAGACTTGTTCTGGGAAGATGAGGAACTAAACTCTATCTTTTCCAAAGAGAAGGTTCAACATGAAGAAGCCTATGGCTATAACAATCTGAACAGTGATGATGATAATAACAACAACAACAATACTAGTAATAATAATGTGCATTTGGACTCTTGTCTCTCTCAGCCTCGTCGTGAGGCAGTGGAATGGATGCTGAAAGTCAATGCTCACTATGGATTCTCTGCTCTCACTGCAACACTGGCCGTTACTTATCTGGATAGGTTCCTTCTAAGCTTCCATTTTCAAAGAGAGAAGCCATGGATGATCCAGCTTGTGGCTGTCACTTGCATCTCTTTGGCTGCAAAAGTTGAAGAAACTCAAGTGCCTCTTCTCTTGGACCTTCAAGTGCAAGACACAAAGTATTTGTTTGAGGCAAAGACTATTCAGAGAATGGAGCTTCTGGTGCTGTCCACACTCAAATGGAAGATGCACCCCGTGACACCACTCTCGTTTCTAGATCACATTATAAGAAGGCTTGGATTGAGAACTCATCTTCACTGGGAGTTTCTCAGGCGCTGTGAGCATCTTCTTCTGTCTGTGCTTTTAGATTCAAGATTTGTTGGTTGTCTTCCTTCTGTGTTGGCCACTGCAACAATGCTGCATGTTATAGACCAGATTCAACACAGTGGTGGGATAGAATACAAAACTCAGCTTCTAAGTGTTCTCAAAATTAGCAAGGAGAAAGTAGATGAGTGTTATAATGCAATTCTCCAACTCTCAAAGGCCAATAAATATGGTCATAACAACATCAACAACACTAGCAAGCGCAAGTATGAGCAAATCCCAAGCAGCCCAAGTGGCGTAATTGATGCTGCATTTTGCTCTGATGGTTCCAACGATTCGTGGGCAGTGGGGTCATCATTGTTATATTCACCACCAGAGCCTCTCTTCAAGAAGAGCAGAACCCAAGGACAACAAATGAATTTGTCACCACTTAAACGGTTCATTATCGGAATTGTTGGCACCTCTCCTTAA

>Glyma10g40990.1   sequence type=predicted peptide   gene model=Glyma10g40990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAIQHHNDQLEHNENVSSVLDALYCDEGKWEEEEEEKEEEEDEGENESEVTTNTATCLFPLLLLEQDLFWEDEELNSIFSKEKVQHEEAYGYNNLNSDDDNNNNNNTSNNNVHLDSCLSQPRREAVEWMLKVNAHYGFSALTATLAVTYLDRFLLSFHFQREKPWMIQLVAVTCISLAAKVEETQVPLLLDLQVQDTKYLFEAKTIQRMELLVLSTLKWKMHPVTPLSFLDHIIRRLGLRTHLHWEFLRRCEHLLLSVLLDSRFVGCLPSVLATATMLHVIDQIQHSGGIEYKTQLLSVLKISKEKVDECYNAILQLSKANKYGHNNINNTSKRKYEQIPSSPSGVIDAAFCSDGSNDSWAVGSSLLYSPPEPLFKKSRTQGQQMNLSPLKRFIIGIVGTSP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo