SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g40590): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g40590): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g40590

Feature Type:gene_model
Chromosome:Gm10
Start:47967725
stop:47970567
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g40590
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G18990AT Annotation by Michelle Graham. TAIR10: thioredoxin domain-containing protein 9 homolog | chr2:8238851-8239932 REVERSE LENGTH=211 SoyBaseE_val: 3.00E-119ISS
GO:0019932GO-bp Annotation by Michelle Graham. GO Biological Process: second-messenger-mediated signaling SoyBaseN/AISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
KOG1672 KOG ATP binding protein JGI ISS
PTHR21148Panther PHOSDUCIN-RELATED JGI ISS
PTHR21148:SF11Panther THIOREDOXIN DOMAIN CONTAINING PROTEIN 9-RELATED JGI ISS
PF00085PFAM Thioredoxin JGI ISS
UniRef100_B9RY61UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thioredoxin domain-containing protein, putative n=1 Tax=Ricinus communis RepID=B9RY61_RICCO SoyBaseE_val: 4.00E-123ISS
UniRef100_I1LEH0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LEH0_SOYBN SoyBaseE_val: 4.00E-153ISS

Expression Patterns of Glyma10g40590
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g40590 not represented in the dataset
Glyma10g40590 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g40590
ParalogEvidenceComments
Glyma20g26720 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g40590 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g259900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g40590
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g40590
>Glyma10g40590.1   sequence type=CDS   gene model=Glyma10g40590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATAAGGGTAAGATCGAAGAGGTGATCGAGAAGCAAGTCCTGACGGTGGCGCAAGCCGTGGAGGACAAGATCGACGACGAGATCGCCGCCCTGGAGCGTCTGGACGCCGATGACATCGAGGCCCTCCGCGAGCGCCGCCTCCAGCAGATGAAGAAGATGGCGGAGAAGCGCTCCCGCTGGATCTCCCTCGGCCACTCCGAATATTCCGAGATTCCCTCCGAGAAAGACTTCTTCCCCGTCGTCAAGGCCAGCGAACGCGTCGTCTGCCACTTCTACCGCGAAAACTGGCCTTGCAAGGTTATGGACAAACACTTAAATATTTTGGCAAAGCAGCATATCGAGACTCGCTTTGTGAAACTCAACGCTGAGAAAAGTCCGTTTCTGGCGGAGAAGCTCAAAATCGTCGTTCTTCCAACTCTTGCCCTCATCAAAAATGCCAAAGTCGATGATTATGTGGTGGGGTTTGATGAACTTGGTGGGACTGATGAGTTTAGCACAGAGGAGCTGGAAGAAAGATTGGCTAAAGCTCAAGTGATCTTTTATGAGGGCGAATCATCGTTCAACCATGCAAGGTCCAGTGCCAAAACCACAAGAAGTGTTCGACAGAGCTCCAGAGCAGACTCCTCAGATTCTGAGTAA
Predicted protein sequences of Glyma10g40590
>Glyma10g40590.1   sequence type=predicted peptide   gene model=Glyma10g40590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDKGKIEEVIEKQVLTVAQAVEDKIDDEIAALERLDADDIEALRERRLQQMKKMAEKRSRWISLGHSEYSEIPSEKDFFPVVKASERVVCHFYRENWPCKVMDKHLNILAKQHIETRFVKLNAEKSPFLAEKLKIVVLPTLALIKNAKVDDYVVGFDELGGTDEFSTEELEERLAKAQVIFYEGESSFNHARSSAKTTRSVRQSSRADSSDSE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo