Report for Sequence Feature Glyma10g40531
Feature Type: gene_model
Chromosome: Gm10
Start: 47911944
stop: 47913100
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g40531
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G19550 AT
Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: mitochondrion; EXPRESSED IN: 15 plant structures; EXPRESSED DURING: 9 growth stages; Has 36 Blast hits to 36 proteins in 8 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 36; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:6787462-6788165 REVERSE LENGTH=110
SoyBase E_val: 7.00E-18 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1NG09 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NG09_SOYBN
SoyBase E_val: 5.00E-54 ISS
UniRef100_Q9LH40 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Gb|AAF18723.1 n=2 Tax=Arabidopsis thaliana RepID=Q9LH40_ARATH
SoyBase E_val: 8.00E-13 ISS
Expression Patterns of Glyma10g40531
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma10g40531
Paralog Evidence Comments
Glyma20g26790 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma10g40531 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g259200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g40531
Coding sequences of Glyma10g40531
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g40531.1 sequence type=CDS gene model=Glyma10g40531 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTTAGAGGAGGCATCACCAAAGCAAGCTTGTCGCTTCTCGGGTCATGCAGGGGAGCTAAGAGAGCCAAGAGTGGACTCAGCAAATTCTCAGGCACTGCTCAACCTGCAGAAAGCTCTGGAGGAGTTTCAAAGAGTGGTGGGAAGATTGAGGATTCAGCTTGCTGGATCCCACACCCACGCACAGGAATTTACTTCCCAAAAGGGCATGAGTGGGTGATGGATGATGTTACAGAGGATGCAGCTCGTTTAAGCCAAACTTATTGGTTCAGAAATGTTGATGGTGTTGACAACCCCGGACACTAA
Predicted protein sequences of Glyma10g40531
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g40531.1 sequence type=predicted peptide gene model=Glyma10g40531 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVRGGITKASLSLLGSCRGAKRAKSGLSKFSGTAQPAESSGGVSKSGGKIEDSACWIPHPRTGIYFPKGHEWVMDDVTEDAARLSQTYWFRNVDGVDNPGH*