Report for Sequence Feature Glyma10g40500
Feature Type: gene_model
Chromosome: Gm10
Start: 47894066
stop: 47894499
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g40500
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G23090 AT
Annotation by Michelle Graham. TAIR10: Uncharacterised protein family SERF | chr2:9829657-9830274 REVERSE LENGTH=78
SoyBase E_val: 4.00E-28 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF04419 PFAM
4F5 protein family
JGI ISS
UniRef100_UPI000233CDB9 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233CDB9 related cluster n=1 Tax=unknown RepID=UPI000233CDB9
SoyBase E_val: 4.00E-39 ISS
Expression Patterns of Glyma10g40500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma10g40500
Paralog Evidence Comments
Glyma20g26830 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma10g40500 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g258900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g40500
Coding sequences of Glyma10g40500
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g40500.2 sequence type=CDS gene model=Glyma10g40500 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGAGGAGGCAATGGGCAGAAGGTCAAGACGGCTTGTGAGAGAAATATATTTTCTCATTTAGTAGGAAGCCAGTTAGAGACCAACAAGAAGGCCATAAACATTCAGTGCAAGGTGTGCATGCAGACGTTCATATCGGAGGTTAAGTGTCGGGAACATGCTGAAGCCAAGCATCCTAAGGCTGATCTCTACACTTGCTTTCCGCATCTTCATAAATAA
Predicted protein sequences of Glyma10g40500
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g40500.2 sequence type=predicted peptide gene model=Glyma10g40500 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGGGNGQKVKTACERNIFSHLVGSQLETNKKAINIQCKVCMQTFISEVKCREHAEAKHPKADLYTCFPHLHK*