SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g40461

Feature Type:gene_model
Chromosome:Gm10
Start:47878767
stop:47881759
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g40461
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G33865AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S14p/S29e family protein | chr4:16233395-16234114 REVERSE LENGTH=56 SoyBaseE_val: 2.00E-31ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG3506 KOG 40S ribosomal protein S29 JGI ISS
PTHR12010Panther FAMILY NOT NAMED JGI ISS
PF00253PFAM Ribosomal protein S14p/S29e JGI ISS
UniRef100_B9R720UniRef Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S29, putative n=2 Tax=fabids RepID=B9R720_RICCO SoyBaseE_val: 7.00E-33ISS
UniRef100_I1R8V8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Oryza RepID=I1R8V8_ORYGL SoyBaseE_val: 4.00E-34ISS

Expression Patterns of Glyma10g40461
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g40461 not represented in the dataset
Glyma10g40461 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g40461
ParalogEvidenceComments
Glyma20g26871 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g40461 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma10g40461
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g40461
>Glyma10g40461.1   sequence type=CDS   gene model=Glyma10g40461   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCTTCGGCGTGTCGCAATTGCTATTGAGAAAACCCTAATTCGAGTAGTTGTCTATAAATTGATATCTGCAGAGTACAAAGAGGGTTCTCCTACAGATTCTTCAGCAACTGCGATTTTGGATCGGAACCTCTTCTGCGGCGTAGCAATGGGACACTCCAACGTTTGGAATTCTCACCCAAAAAACTACGGTCCTGGTTCTCGCACTTGCCGAGTGTGTGGGAATCCACATGGATTGATCAGGAAGTATGGCCTTATGTGCTGCAGGCAGTGCTTCCGTAGCAATGCCAAGGAAATTGGCTTCATCAAGGTACATTTGAATGTGCTTTTCTTAATTTTTGTCTTCGAACTTGTTCAATTTGAATTTACCTGTATCAAACTTTTTTGTGCTTCGTGGTTGGTTTGCTTATCGCTAAAAGAGCTGTTGTCACCTACGGACCAATATTATGTTCTGGCACTAGGATGTTTTGAAGATGTTATGTTTGAAGAAACTTGA
Predicted protein sequences of Glyma10g40461
>Glyma10g40461.1   sequence type=predicted peptide   gene model=Glyma10g40461   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKLRRVAIAIEKTLIRVVVYKLISAEYKEGSPTDSSATAILDRNLFCGVAMGHSNVWNSHPKNYGPGSRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKVHLNVLFLIFVFELVQFEFTCIKLFCASWLVCLSLKELLSPTDQYYVLALGCFEDVMFEET*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo