Glyma10g40280 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g40280): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g40280): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g40280

Feature Type:	gene_model
Chromosome:	Gm10
Start:	47747807
stop:	47748984
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g40280

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G04640	AT	Annotation by Michelle Graham. TAIR10: lipoyltransferase 2 \| chr1:1292541-1293248 FORWARD LENGTH=235	SoyBase	E_val: 3.00E-116	ISS
GO:0000096	GO-bp	Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process	SoyBase	N/A	ISS
GO:0006098	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt	SoyBase	N/A	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0006464	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular protein modification process	SoyBase	N/A	ISS
GO:0006546	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycine catabolic process	SoyBase	N/A	ISS
GO:0006636	GO-bp	Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0006733	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidoreduction coenzyme metabolic process	SoyBase	N/A	ISS
GO:0006766	GO-bp	Annotation by Michelle Graham. GO Biological Process: vitamin metabolic process	SoyBase	N/A	ISS
GO:0008652	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process	SoyBase	N/A	ISS
GO:0009072	GO-bp	Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family metabolic process	SoyBase	N/A	ISS
GO:0009106	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipoate metabolic process	SoyBase	N/A	ISS
GO:0009107	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipoate biosynthetic process	SoyBase	N/A	ISS
GO:0009108	GO-bp	Annotation by Michelle Graham. GO Biological Process: coenzyme biosynthetic process	SoyBase	N/A	ISS
GO:0009117	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process	SoyBase	N/A	ISS
GO:0009249	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein lipoylation	SoyBase	N/A	ISS
GO:0009695	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process	SoyBase	N/A	ISS
GO:0015995	GO-bp	Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process	SoyBase	N/A	ISS
GO:0019243	GO-bp	Annotation by Michelle Graham. GO Biological Process: methylglyoxal catabolic process to D-lactate	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0019748	GO-bp	Annotation by Michelle Graham. GO Biological Process: secondary metabolic process	SoyBase	N/A	ISS
GO:0044272	GO-bp	Annotation by Michelle Graham. GO Biological Process: sulfur compound biosynthetic process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0016415	GO-mf	Annotation by Michelle Graham. GO Molecular Function: octanoyltransferase activity	SoyBase	N/A	ISS
GO:0017118	GO-mf	Annotation by Michelle Graham. GO Molecular Function: lipoyltransferase activity	SoyBase	N/A	ISS
GO:0033819	GO-mf	Annotation by Michelle Graham. GO Molecular Function: lipoyl(octanoyl) transferase activity	SoyBase	N/A	ISS
KOG0325	KOG	Lipoyltransferase	JGI		ISS
PTHR10993	Panther	LIPOATE-PROTEIN LIGASE B	JGI		ISS
PTHR10993:SF0	Panther		JGI		ISS
PF03099	PFAM	Biotin/lipoate A/B protein ligase family	JGI		ISS
UniRef100_Q9SXP7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Octanoyltransferase n=2 Tax=Arabidopsis thaliana RepID=LIPB_ARATH	SoyBase	E_val: 2.00E-113	ISS
UniRef100_UPI000233CDB5	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233CDB5 related cluster n=1 Tax=unknown RepID=UPI000233CDB5	SoyBase	E_val: 2.00E-169	ISS

Expression Patterns of Glyma10g40280

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g40280 not represented in the dataset	Glyma10g40280 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g40280

Paralog	Evidence	Comments
Glyma20g27060	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g40280 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g256700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g40280

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g40280

Limit To All Plant Sequences

>Glyma10g40280.1   sequence type=CDS   gene model=Glyma10g40280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGGTTTGCGAAGCCTTGAGGTCTGGAAACTAGGAGTTGTCAACTCTTTGGATGCATTGAAACTGCAGGAAAAACTGGCCTTGGATAGAAAACTTCATAGGAGATGTGATACTATTCTTCTGTCTTTGCAACACCCCCCTACATACACTGTTGGCAAAAGGCAAACTGTTCACAATTTGTTAATCCCCCAATCCGAGTTTTTGGACAAAATTGGAGCTGAACTTCACTACATGCGAAGGGGAGGAGACATTACATTTCATGGTCCCTACCAGGCCATTTTGCATCCTATCATATCGCTCCGCACCATGGGACTCGATGCTCGATGTTTTGTGGAGAAGATTGAGTTAACCATGATTGAACTGGCTGCTACATACTGTGTGAAAGCTTGTCCTGGACAAAGTGGTGAGACTGGGGTATGGATTGGAGAAAGGAAGATAGGTGCGATTGGTGTTCGGATATCAAGTGGAATCACTTCTCATGGGATGGCATTTAACATTGATCCTGATTTGAGCTACTTTAAGCACATTGTTCCCTGTGGAATTGCAGATATAGAAGTAACATCTTTGAGAAGGGAGACAGATTCTGTTCTTCCTGAGGAAGAAATAATACAGGAGCAGTTGATTTCATGTTTTGCAAGAATCTTCAGTTATAGGGACCTAATCTGGAAGGAGGATGCTTCAATATTTTTTTGA

Predicted protein sequences of Glyma10g40280

Limit To All Plant Sequences

>Glyma10g40280.1   sequence type=predicted peptide   gene model=Glyma10g40280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKGLRSLEVWKLGVVNSLDALKLQEKLALDRKLHRRCDTILLSLQHPPTYTVGKRQTVHNLLIPQSEFLDKIGAELHYMRRGGDITFHGPYQAILHPIISLRTMGLDARCFVEKIELTMIELAATYCVKACPGQSGETGVWIGERKIGAIGVRISSGITSHGMAFNIDPDLSYFKHIVPCGIADIEVTSLRRETDSVLPEEEIIQEQLISCFARIFSYRDLIWKEDASIFF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain