Glyma10g40210 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g40210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g40210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g40210

Feature Type:	gene_model
Chromosome:	Gm10
Start:	47688235
stop:	47690211
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g40210

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G49975	AT	Annotation by Michelle Graham. TAIR10: INVOLVED IN: photosynthesis; LOCATED IN: photosystem I, chloroplast, thylakoid membrane; EXPRESSED IN: 20 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Photosystem I reaction centre subunit N (InterPro:IPR008796); Has 34 Blast hits to 34 proteins in 14 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 34; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr1:18504845-18505431 FORWARD LENGTH=129	SoyBase	E_val: 5.00E-42	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009522	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: photosystem I	SoyBase	N/A	ISS
GO:0042651	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid membrane	SoyBase	N/A	ISS
GO:0005516	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calmodulin binding	SoyBase	N/A	ISS
PF05479	PFAM	Photosystem I reaction centre subunit N (PSAN or PSI-N)	JGI		ISS
UniRef100_I1LED1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LED1_SOYBN	SoyBase	E_val: 1.00E-92	ISS
UniRef100_Q6AVG2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6AVG2_ORYSJ	SoyBase	E_val: 1.00E-16	ISS

Expression Patterns of Glyma10g40210

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g40210 not represented in the dataset	Glyma10g40210 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g40210 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g256000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g40210

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g40210

Limit To All Plant Sequences

>Glyma10g40210.1   sequence type=CDS   gene model=Glyma10g40210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTAGTTCAATAGGGCAAAGCATATTGATGGCACTAACTGTTACAGTAAACAAGTATGCTTCATCTAATCTGCAAGCTGTTCCCAGAACACAAGGAAAAGTAGCAACCAAAAAAACCACACCAACCTTAAGCACCAATGTGGAAATGGGAAGAAGAGGACTTGTCTTATCCACTGTAATCGCCACCACGCAAGTACCTGAACCTGACTCTAGGACTCAGCTTCTTAAAAAATATCAGAAGAAATCAGAGGAAAACAAGGAGAAAAATGACAAAGAGAGGCTGGAGAGTTATTACAAGCGTAACTACAAGGATTACTTTGAATTGATGGAAGGGACATTGAAGGCAAAGGATGGGAAGCTTTCTGATACAGAAAAGGGTATCCTTGATTGGCTTCAAAAAAACAAGTGA

Predicted protein sequences of Glyma10g40210

Limit To All Plant Sequences

>Glyma10g40210.1   sequence type=predicted peptide   gene model=Glyma10g40210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSSIGQSILMALTVTVNKYASSNLQAVPRTQGKVATKKTTPTLSTNVEMGRRGLVLSTVIATTQVPEPDSRTQLLKKYQKKSEENKEKNDKERLESYYKRNYKDYFELMEGTLKAKDGKLSDTEKGILDWLQKNK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain