SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g39890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g39890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g39890

Feature Type:gene_model
Chromosome:Gm10
Start:47464857
stop:47466848
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G05200AT Annotation by Michelle Graham. TAIR10: cysteine-rich RLK (RECEPTOR-like protein kinase) 25 | chr4:2679793-2682309 REVERSE LENGTH=675 SoyBaseE_val: 6.00E-54ISS
GO:0000041GO-bp Annotation by Michelle Graham. GO Biological Process: transition metal ion transport SoyBaseN/AISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006826GO-bp Annotation by Michelle Graham. GO Biological Process: iron ion transport SoyBaseN/AISS
GO:0010106GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0010413GO-bp Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0045492GO-bp Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR11795Panther PROTEIN KINASE JGI ISS
PTHR11795:SF83Panther RECEPTOR SERINE/THREONINE PROTEIN KINASE-RELATED JGI ISS
PF01657PFAM Domain of unknown function DUF26 JGI ISS
UniRef100_C6ZRN5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cysteine-rich protein n=1 Tax=Glycine max RepID=C6ZRN5_SOYBN SoyBaseE_val: 3.00E-100ISS
UniRef100_UPI000233CC3FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233CC3F related cluster n=1 Tax=unknown RepID=UPI000233CC3F SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g39890 not represented in the dataset

Glyma10g39890 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g252900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g39890.2   sequence type=CDS   gene model=Glyma10g39890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCCTAAATTCCTTCAAACATTATCCTCTCTTCACGTTTCTTATGTTTACTCTCACTGAAGCATCATCAGATGTTCCTATTTTCCTTCGCGAAAACTGCACAACCATCGAAACCTTCATCTCCAACACCACTTTCCAGTTCAACCTCATAACCCTCTTGTCTTCTCTATCTTCCAACGCCACCGGAAACACCCAATTCTACAACACCACCTTATCCGGCAAAAGCTCCTCCGACACCGTCTACGGCCTCTTCCTCTGCCGTGGTGACGTGCCCCCTCAACTTTGCCAACAGTGCGTGTTGAACGCAATCCAAAGACTAAGCAATCAAAGCTCAGATACATGCAAGTTTGCCAAAAGTGCTATAATTTGGTATGACGAGTGTTTGGTTCGCTATTCCAACAGGTATTTCTTCTCCACGGTGGACACAAGGCCTAGAATGCGTTTGCGAAACACTGCCAACGTTTCCGACACAAAAAGCTTCTTGCGTTTGTTGTACACCACTTTGAATGAAACTGCAGATGAGGCAGCGAATTCTTCGAACGGTGCTAAGTTATACGCCACAAAGCAAGCTAAGATCTCTGGGTTTCAGACCCTCTATTGTATGACTCAGTGTACACCGGATTTGTCACCCCAAGATTGCAGAAGGTGTCTCAGTGGTGTGATAGGGGATCTTTCTTGGTGTTGTCCTGGAAGCCAAGGAGGAAGAGTTTTGTATCCAAGTTGTAACTTTAGGTATGAGTTGTACCCTTTCTATAGAATGGATTCCCCGGCACCTGAAGGAATTATTAGTCCAACACATTCTACAATGGATAAAGGTGAAGCAGGAAAGAAAGGAATCTCATCAGAGATAGCAACTGCAACCTTTGTTTCGATTACTGTCGCAGGGCTGTCTTGGGTATTTGGTTCTTAA

>Glyma10g39890.2   sequence type=predicted peptide   gene model=Glyma10g39890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALNSFKHYPLFTFLMFTLTEASSDVPIFLRENCTTIETFISNTTFQFNLITLLSSLSSNATGNTQFYNTTLSGKSSSDTVYGLFLCRGDVPPQLCQQCVLNAIQRLSNQSSDTCKFAKSAIIWYDECLVRYSNRYFFSTVDTRPRMRLRNTANVSDTKSFLRLLYTTLNETADEAANSSNGAKLYATKQAKISGFQTLYCMTQCTPDLSPQDCRRCLSGVIGDLSWCCPGSQGGRVLYPSCNFRYELYPFYRMDSPAPEGIISPTHSTMDKGEAGKKGISSEIATATFVSITVAGLSWVFGS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo