SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g39770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g39770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g39770

Feature Type:gene_model
Chromosome:Gm10
Start:47388417
stop:47391276
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g39770
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G61780AT Annotation by Michelle Graham. TAIR10: postsynaptic protein-related | chr1:22812822-22814016 REVERSE LENGTH=98 SoyBaseE_val: 9.00E-57ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3476 KOG Microtubule-associated protein CRIPT JGI ISS
PTHR11800Panther DNA-DIRECTED RNA POLYMERASE JGI ISS
PF10235PFAM Microtubule-associated protein CRIPT JGI ISS
UniRef100_B6T114UniRef Annotation by Michelle Graham. Most informative UniRef hit: Postsynaptic protein CRIPT n=2 Tax=Andropogoneae RepID=B6T114_MAIZE SoyBaseE_val: 4.00E-58ISS
UniRef100_C6SZD4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZD4_SOYBN SoyBaseE_val: 2.00E-63ISS

Expression Patterns of Glyma10g39770
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g39770 not represented in the dataset
Glyma10g39770 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g39770
ParalogEvidenceComments
Glyma20g27960 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g39770 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g251800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g39770
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g39770
>Glyma10g39770.1   sequence type=CDS   gene model=Glyma10g39770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTCTGCGAGAAGTGTGAGAAGAAATTATCGAAGGTGATAGTACCAGACAAATGGAAAGAAGGGGCCAGCAATACTACCGAGGGTGGTGGCCGCAAGATCAACGAGAACAAGCTTCTCTCCAAGAAAAACAGATGGACCCCTTACGGAAACACTAAGTGCACCATTTGCAAGCAGCAAGTGCACCAGAATGCTAAGTACTGCCACACCTGTGCTTACTCTAAAGGAGTTTGTGCAATGTGTGGAAAGCAAGTTCTTGATACCAAGTTTTACAAACAAAGCAATGTGTAG
Predicted protein sequences of Glyma10g39770
>Glyma10g39770.1   sequence type=predicted peptide   gene model=Glyma10g39770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVCEKCEKKLSKVIVPDKWKEGASNTTEGGGRKINENKLLSKKNRWTPYGNTKCTICKQQVHQNAKYCHTCAYSKGVCAMCGKQVLDTKFYKQSNV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo