SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g39740): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g39740): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g39740

Feature Type:gene_model
Chromosome:Gm10
Start:47374131
stop:47375767
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G54770AT Annotation by Michelle Graham. TAIR10: thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) | chr5:22246634-22247891 FORWARD LENGTH=349 SoyBaseE_val: 0ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0006974GO-bp Annotation by Michelle Graham. GO Biological Process: response to DNA damage stimulus SoyBaseN/AISS
GO:0009228GO-bp Annotation by Michelle Graham. GO Biological Process: thiamine biosynthetic process SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0010155GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of proton transport SoyBaseN/AISS
GO:0018131GO-bp Annotation by Michelle Graham. GO Biological Process: oxazole or thiazole biosynthetic process SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043085GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity SoyBaseN/AISS
GO:0046777GO-bp Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0010319GO-cc Annotation by Michelle Graham. GO Cellular Compartment: stromule SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0042803GO-mf Annotation by Michelle Graham. GO Molecular Function: protein homodimerization activity SoyBaseN/AISS
KOG2960 KOG Protein involved in thiamine biosynthesis and DNA damage tolerance JGI ISS
PTHR10617Panther FLAVOPROTEIN-UBIQUINONE OXIDOREDUCTASE JGI ISS
PTHR10617:SF54Panther THIAZOLE BIOSYNTHETIC ENZYME, MITOCHONDRIAL JGI ISS
PF01946PFAM Thi4 family JGI ISS
UniRef100_F6H7K5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thiamine thiazole synthase 2, chloroplastic n=2 Tax=Vitis vinifera RepID=THI42_VITVI SoyBaseE_val: 0ISS
UniRef100_I1LE84UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LE84_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g39740 not represented in the dataset

Glyma10g39740 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma20g27990 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g251500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g39740.1   sequence type=CDS   gene model=Glyma10g39740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGCCATGGCAACCACAACCCTCTCTTCAAACCCGAAACTCTCATTTTTCCACGGAAAGCCCGTTACATATTCTTCCCGCGTCGCACCCACCACCAAGTTATTCTCATCCAAACAAGGCACAATCTCCATGTCCCTAACCCAACCCCCATACGACCTCCAATCCTTCAAATTCCAACCCATCAAAGAATCCATCGTCTCACGCGAAATGACGCGCCGCTACATGACCGACATGATAACCTACGCCGACACCGACGTCGTAATCGTCGGAGCCGGCTCGGCGGGGCTCTCCTGTGCGTACGAGATCAGCAAGAACCCCGCCGTGAGCGTCGCCATAATCGAGCAGTCCGTGAGCCCCGGCGGCGGCGCGTGGCTCGGCGGACAACTCTTCTCCGCCATGGTGGTTCGCAAGCCGGCGCACCTCTTCCTGGACGAGCTCGGCGTGGCGTACGACGAGCAAGAGGACTACGTTGTGATAAAGCACGCGGCTTTGTTCACGTCCACCATCATGAGCAGGCTTCTAGCGAGGCCCAACGTGAAGCTCTTCAACGCGGTGGCGGCGGAGGACTTGATCGTGAAGGAAGGGAGGGTTGCAGGGGTTGTGACCAACTGGGCTCTGGTTTCGATGAACCATGACACGCAGTCTTGCATGGACCCCAACGTGATGGAGGCTAAGGTTGTTGTGAGCTCTTGTGGGCACGATGGACCTTTTGGCGCCACCGGGGTTAAGAGGTTGAAGAGTATTGGCATGATTGATAGCGTTCCTGGAATGAAGGCTTTGGATATGAATGCTGCAGAGGATGCTATTGTGAGGCTCACGAGGGAGATTGTGCCCGGCATGATTGTCACCGGCATGGAGGTGGCAGAAATTGATGGCTCCCCAAGGATGGGTCCGACGTTTGGGGCGATGATGATATCAGGGCAGAAGGCGGCTCATTTGGCGTTGAAGGCGTTGGGGAGGAACAATGCAATTGATGGAACGTGTGGAGTTGGAAGGGAAGAACCCCAGCTTATTTTCGCTTCTGCAGACACTGAGGAAATTGTTGATGCTTAA

>Glyma10g39740.1   sequence type=predicted peptide   gene model=Glyma10g39740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAMATTTLSSNPKLSFFHGKPVTYSSRVAPTTKLFSSKQGTISMSLTQPPYDLQSFKFQPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYEISKNPAVSVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEQEDYVVIKHAALFTSTIMSRLLARPNVKLFNAVAAEDLIVKEGRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGRNNAIDGTCGVGREEPQLIFASADTEEIVDA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo